BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30352 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 4.6 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 6.1 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 6.1 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.1 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 23 6.1 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 6.1 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 8.1 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 8.1 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 8.1 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 448 HSPWNIRYKIQREPKSLRRPRGSKRSVRMG 359 H P +R + + ++ PRGS R R G Sbjct: 817 HDPQKLRIVVSKSANAMHPPRGS-RHTRQG 845 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 Query: 448 HSPWNIRYKIQREPKSL 398 H PWN +QR K L Sbjct: 445 HEPWNASESVQRAAKCL 461 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 383 LQTIRENGIIDNPNG 339 LQT ENG NPNG Sbjct: 303 LQTFDENGRNGNPNG 317 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 288 INTPKYQLLPFDSIQRRAVRIVDNPILTDRL 380 + P+ L+ FD + A +++D I+TD L Sbjct: 2943 VGRPESTLI-FDKLPSAASKVIDEIIITDNL 2972 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 383 LQTIRENGIIDNPNG 339 LQT ENG NPNG Sbjct: 156 LQTFDENGRNGNPNG 170 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 383 LQTIRENGIIDNPNG 339 LQT ENG NPNG Sbjct: 303 LQTFDENGRNGNPNG 317 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 503 GGAMVKTRCRYHLEQFLRALPMEHTVQNTEGTEVPPQT 390 GG +R +HL + ++ V + +GT++P T Sbjct: 466 GGGGGGSRYEHHLSRHASSILPSSLVSSPDGTDLPHHT 503 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 503 GGAMVKTRCRYHLEQFLRALPMEHTVQNTEGTEVPPQT 390 GG +R +HL + ++ V + +GT++P T Sbjct: 442 GGGGGGSRYEHHLSRHASSILPSSLVSSPDGTDLPHHT 479 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 22.6 bits (46), Expect = 8.1 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -1 Query: 483 EMPVSSRTIPQSTPHGTYGTKYRGNRSPSADPEAPNDP 370 E P+ R P Y + R N P+A P PNDP Sbjct: 176 ENPLLYRDRTPYNPSRDYDDRNRYN--PNARPYNPNDP 211 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,900 Number of Sequences: 2352 Number of extensions: 13402 Number of successful extensions: 34 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -