BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30332 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 24 1.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 3.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 3.3 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 21 5.7 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 21 5.7 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 324 KGIVKVGALDADEHRSVSQKYGVT 395 KGI+K L+ EHRS S K G+T Sbjct: 587 KGIMKTYWLEKREHRSSSTK-GIT 609 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 439 GVCLLPVNILIVGKPVTPYFCDTLLCSSAS 350 G LL + +L P+ FC L CS+A+ Sbjct: 134 GWLLLMLYLLFATLPLRLSFCVVLACSTAT 163 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/37 (24%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 374 ITEIWSHW-LPHN*DIHREQAHTISRSEDSRRIC*SC 481 ++ ++SH+ +N ++ RE+ + +ED +C C Sbjct: 238 VSIMFSHYDRNNNGNLEREELEQFAENEDLEELCRGC 274 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 292 TRLLQCPHHGAKNSMIQ 242 +RL++C HH +N+ I+ Sbjct: 145 SRLMRCLHHDIENAHIR 161 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.4 bits (43), Expect = 5.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +2 Query: 311 CESSKGHCKSRCL 349 C++ GHC CL Sbjct: 36 CQAVNGHCSHLCL 48 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 21.4 bits (43), Expect = 5.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +2 Query: 311 CESSKGHCKSRCL 349 C++ GHC CL Sbjct: 36 CQAVNGHCSHLCL 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,263 Number of Sequences: 438 Number of extensions: 3182 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -