BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30329 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 25 2.0 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 3.5 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 3.5 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 23 4.6 AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 23 6.1 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 6.1 Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 23 8.1 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 23 8.1 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 24.6 bits (51), Expect = 2.0 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = +3 Query: 150 YYGNTSFKSDTCKSKL---NELPSFATLDDLHLKPSRQKRNPASATQPCRMDTCFDFSKC 320 Y T K + K K+ NE+ + A LDD +K + + QP +M K Sbjct: 176 YVDPTKIKEELAKKKMEAMNEVAADADLDDAKMKKTPDSIDRVDHEQPEKMS--LSLKKL 233 Query: 321 GSD 329 G D Sbjct: 234 GLD 236 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 3.5 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -2 Query: 371 STDSPITWVHKNFWITSTFRKVETCIHTTRLCCRSRIAFLSRW 243 +T P+ +FW K T + TRL RSRI W Sbjct: 746 ATQGPLQETFGDFWRMCWELKSSTIVMMTRLEERSRIKCTMYW 788 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 414 VTRDPNEACLFVPAIDTLDADPLSSEHVSD 503 + R P+ +C F AIDTL+ V+D Sbjct: 977 MNRVPSPSCSFCSAIDTLEHKFAGCRRVAD 1006 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 505 TSDTCSDDKGSASSVSIAGTNKHASFGSLV 416 T+ C+ + ++S GT++HAS G++V Sbjct: 85 TAAHCTAGRSTSSLTVPLGTSRHASGGTVV 114 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 23.0 bits (47), Expect = 6.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 365 DSPITWVHKNFWITSTFRKVETCIHTTRLCCR 270 D+P ++ NFWI S K+ CI T L R Sbjct: 240 DNPAL-LNVNFWIYSVVFKLIPCIALTILSLR 270 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 6.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 328 SLPHLEKSKHVSIRQGCVAEAGLRFCLD 245 +L + +HV+ R G + + GL C D Sbjct: 486 ALTQAPRVRHVAPRAGLLRDCGLELCPD 513 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 505 TSDTCSDDKGSASSVSIAGTNKHASFGSLV 416 T+ C+D S G+++HAS GS++ Sbjct: 86 TAAHCTDGSQPESLTVRLGSSRHASGGSVI 115 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 322 PHLEKSKHVSIRQGCVAEAG 263 PHL+++ +VS G A+AG Sbjct: 374 PHLQQNGYVSASNGQSAQAG 393 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,568 Number of Sequences: 2352 Number of extensions: 10864 Number of successful extensions: 25 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -