BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30327 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 27 0.50 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 24 3.5 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 24 3.5 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 24 3.5 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 4.6 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 6.1 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 23 6.1 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 23 6.1 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 8.1 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 26.6 bits (56), Expect = 0.50 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -2 Query: 245 KKRIITLRKSLRVHTKR--AALEKINLKFIDTSSKFGHGRFQTPADKAAFMGTLKK 84 KK++ L + + +R A +EKIN FI S+ G+ + P D LKK Sbjct: 53 KKKVFKLARLIPAVRRRVDAEIEKINAGFIKDISQTGNYYTELPHDSMGQAEILKK 108 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 23.8 bits (49), Expect = 3.5 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -2 Query: 185 EKINLKFIDTSSKFGH-GRFQTPADKAAFMG 96 EKI S FG R+QTPAD MG Sbjct: 288 EKIKAGKSKLSDYFGEFNRYQTPADAVCEMG 318 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 23.8 bits (49), Expect = 3.5 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 165 H*HLVQVRSWSIPDAG*QG-CIHGYTQEGSYSRRSCGYHNPSG 40 H H + S DA Q C Y EGSYS + CG SG Sbjct: 56 HLHQTRTAQESPYDASIQAACKQIY--EGSYSSKDCGTKGTSG 96 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 23.8 bits (49), Expect = 3.5 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 165 H*HLVQVRSWSIPDAG*QG-CIHGYTQEGSYSRRSCGYHNPSG 40 H H + S DA Q C Y EGSYS + CG SG Sbjct: 56 HLHQTRTAQESPYDASIQAACKQIY--EGSYSSKDCGTKGTSG 96 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 413 YRIGQGIHKKDGKVIKNNASTEYDL 339 YR+ G+H D +I+ A EY++ Sbjct: 203 YRVNAGVHVNDIVLIELAADVEYNV 227 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 70 SRIRSFLSVPMNAALSAGVWNRP*PNLDEVSMNLRLIFSSAA 195 S+ R ++VP + AG + P+L E++ +L+L+ A Sbjct: 109 SQQREEMTVPATSTPKAGKCSSAEPSLSEMNESLKLLAMQVA 150 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.0 bits (47), Expect = 6.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 188 LEKINLKFIDTSSKFGHGRFQTPADKAAFMGTLKKDRIREE 66 ++ IN++ I T+ +Q KA +KD+IREE Sbjct: 76 VDDINVEQISTNQAGYDQAYQEAIAKAVTACMAQKDKIREE 116 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.0 bits (47), Expect = 6.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 188 LEKINLKFIDTSSKFGHGRFQTPADKAAFMGTLKKDRIREE 66 ++ IN++ I T+ +Q KA +KD+IREE Sbjct: 225 VDDINVEQISTNQAGYDQAYQEAIAKAVTACMAQKDKIREE 265 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 370 ITLPSFLWIPCPIR*IFLFI 429 I +PS +P P+R +FL + Sbjct: 268 IPMPSITEVPIPVRFLFLLL 287 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,007 Number of Sequences: 2352 Number of extensions: 11579 Number of successful extensions: 24 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -