BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30327 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43170.2 68414.m04975 60S ribosomal protein L3 (RPL3A) identi... 202 1e-52 At1g43170.1 68414.m04974 60S ribosomal protein L3 (RPL3A) identi... 202 1e-52 At1g61580.1 68414.m06939 60S ribosomal protein L3 (RPL3B) identi... 200 3e-52 At5g44770.1 68418.m05487 DC1 domain-containing protein contains ... 29 1.9 At3g60400.1 68416.m06755 mitochondrial transcription termination... 29 1.9 At5g22400.1 68418.m02613 rac GTPase activating protein, putative... 28 4.3 At4g38360.2 68417.m05424 expressed protein contains Pfam profile... 27 5.7 At2g02700.1 68415.m00210 DC1 domain-containing protein contains ... 27 7.5 At3g48400.1 68416.m05283 DC1 domain-containing protein similar t... 27 9.9 At3g45510.1 68416.m04914 zinc finger (C3HC4-type RING finger) fa... 27 9.9 At3g23210.1 68416.m02926 basic helix-loop-helix (bHLH) family pr... 27 9.9 >At1g43170.2 68414.m04975 60S ribosomal protein L3 (RPL3A) identical to ribosomal protein GI:166858 from [Arabidopsis thaliana] Length = 389 Score = 202 bits (493), Expect = 1e-52 Identities = 94/144 (65%), Positives = 112/144 (77%) Frame = -2 Query: 515 VACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHKKDGKVIKNNASTEYDLS 336 VACIGAWHP+RVS+TVARAGQ GYHHRTE+NKKIYR+G K G + A TEYD + Sbjct: 252 VACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLG-----KVGTEA-HTAMTEYDRT 305 Query: 335 EKSITPMGGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEKINLKFIDT 156 EK +TPMGGFPHYG V +D++MIKGCC+GPKKR++TLR+SL T R ALE+I LKFIDT Sbjct: 306 EKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDT 365 Query: 155 SSKFGHGRFQTPADKAAFMGTLKK 84 +S FGHGRFQT +K F + K Sbjct: 366 ASIFGHGRFQTSLEKMRFYNRVTK 389 >At1g43170.1 68414.m04974 60S ribosomal protein L3 (RPL3A) identical to ribosomal protein GI:166858 from [Arabidopsis thaliana] Length = 389 Score = 202 bits (493), Expect = 1e-52 Identities = 94/144 (65%), Positives = 112/144 (77%) Frame = -2 Query: 515 VACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHKKDGKVIKNNASTEYDLS 336 VACIGAWHP+RVS+TVARAGQ GYHHRTE+NKKIYR+G K G + A TEYD + Sbjct: 252 VACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLG-----KVGTEA-HTAMTEYDRT 305 Query: 335 EKSITPMGGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEKINLKFIDT 156 EK +TPMGGFPHYG V +D++MIKGCC+GPKKR++TLR+SL T R ALE+I LKFIDT Sbjct: 306 EKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDT 365 Query: 155 SSKFGHGRFQTPADKAAFMGTLKK 84 +S FGHGRFQT +K F + K Sbjct: 366 ASIFGHGRFQTSLEKMRFYNRVTK 389 >At1g61580.1 68414.m06939 60S ribosomal protein L3 (RPL3B) identical to ribosomal protein GI:806279 from [Arabidopsis thaliana] Length = 390 Score = 200 bits (489), Expect = 3e-52 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 1/144 (0%) Frame = -2 Query: 515 VACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHKKDGKVIKNNASTEYDLS 336 VACIGAWHP+RVS+TVARAGQ GYHHRTEMNKK+YR+G K G+ ++A TEYD + Sbjct: 252 VACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVG-----KVGQET-HSAMTEYDRT 305 Query: 335 EKSITPMGGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEKINLKFIDT 156 EK ITPMGGFPHYG V D++MIKGCC+GPKKR++TLR++L T R A+E+I LKFID Sbjct: 306 EKDITPMGGFPHYGIVKEDYLMIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKLKFIDA 365 Query: 155 SSKFGHGRFQTPADKAAFMG-TLK 87 +S GHGRFQT +KA F G T+K Sbjct: 366 ASNGGHGRFQTSQEKAKFYGRTIK 389 >At5g44770.1 68418.m05487 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 541 Score = 29.1 bits (62), Expect = 1.9 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 3/85 (3%) Frame = -2 Query: 326 ITPMGGFPHYGEVNNDFVMIKGCCMGPKKRIITLRK---SLRVHTKRAALEKINLKFIDT 156 I P+ P Y V DF + KGC P+K+ L SLR H ++K Sbjct: 286 ILPINDDPCYKCVECDFCLHKGCASLPRKKAHFLHNHKISLRAHKDDVYVDKCG-----A 340 Query: 155 SSKFGHGRFQTPADKAAFMGTLKKD 81 + +G DK++ G +K D Sbjct: 341 CKTYSNGFKYECHDKSSCRGNIKYD 365 >At3g60400.1 68416.m06755 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 558 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -2 Query: 446 YHHRTEMNKKIYRIGQGIHKKDGK--VIKNNASTEYDLSEKSITPMGGFPHYG 294 Y MNK Y G+ K+D +++N A +DL + I+ G H+G Sbjct: 262 YSEEALMNKAGYFCRFGVSKEDAALLILRNPAIMNFDLEKPVISVTGMLKHFG 314 >At5g22400.1 68418.m02613 rac GTPase activating protein, putative similar to rac GTPase activating protein 1 [Lotus japonicus] GI:3695059; contains Pfam profile PF00620: RhoGAP domain Length = 466 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 178 STSNSLTPRPSSVMVDSRRRLTRLHSWVHSRR 83 S+S+S +P PSS+ SR T L S H+RR Sbjct: 17 SSSSSSSPSPSSLSYASRSNATLLISSDHNRR 48 >At4g38360.2 68417.m05424 expressed protein contains Pfam profile PF03619: Domain of unknown function Length = 485 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -2 Query: 482 VSFTVARAGQKGYHHRTEMNKKIYRIGQGI--HKKDGKVIKNNASTEYDLSEKSI 324 V FTV +A + T+ N+K+++I Q I H K+ + +K+++ S + I Sbjct: 373 VRFTVTQAVEPMEKSITKFNEKLHKISQNIKKHDKEKRRVKDDSCMSSSPSRRVI 427 >At2g02700.1 68415.m00210 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 499 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 5/78 (6%) Frame = -2 Query: 452 KGYHHRTEMNKKIYRIGQGI--HKKDGKVIK---NNASTEYDLSEKSITPMGGFPHYGEV 288 +G ++ YRI GI H G +K N E + + + P+ Y V Sbjct: 336 EGVPEDKDVELPFYRIADGIILHFSHGCHMKFETNGVYKENEFCQACVLPINEENFYVCV 395 Query: 287 NNDFVMIKGCCMGPKKRI 234 DF++ + C P+K++ Sbjct: 396 KCDFILHEKCADAPRKKV 413 >At3g48400.1 68416.m05283 DC1 domain-containing protein similar to UV-B light insensitive ULI3 [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 619 Score = 26.6 bits (56), Expect = 9.9 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 5/69 (7%) Frame = -2 Query: 392 HKKDGKVI-KNNASTEYD---LSEKSITPMGGFPHYGEVNNDFVMIKGCCMGP-KKRIIT 228 H+K ++ KN T++D + + P+ P Y D+V+ + C P KKR + Sbjct: 375 HEKHNLMLNKNGIITQHDEITRCQACVLPLSSDPSYSCGQCDYVLHETCANLPRKKRHVF 434 Query: 227 LRKSLRVHT 201 K +HT Sbjct: 435 NNKPFTLHT 443 >At3g45510.1 68416.m04914 zinc finger (C3HC4-type RING finger) family protein contains a zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 257 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 400 KESTKRMAKLLKTMHLLSMICLRNPLHRWEV 308 KE + K T+ L ++C+RNP+ W + Sbjct: 201 KEYKMKGNKATTTVWLYVLLCMRNPMEAWRL 231 >At3g23210.1 68416.m02926 basic helix-loop-helix (bHLH) family protein similar to hypothetical protein GB:CAB10220 from [Arabidopsis thaliana] Length = 320 Score = 26.6 bits (56), Expect = 9.9 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -2 Query: 257 CMGPKKRIITLRK-SLRVHTKRAALEKINLKFIDTSSKFGHGRFQTP-ADKAAFM 99 C G ++R + K + ++ EK+N KF+D SS GR TP DK+A + Sbjct: 151 CSGKRRRTGSCSKPGTKACREKLRREKLNDKFMDLSSVLEPGR--TPKTDKSAIL 203 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,285,808 Number of Sequences: 28952 Number of extensions: 238846 Number of successful extensions: 639 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -