BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30326 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 132 2e-31 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 4e-22 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 44 7e-05 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 41 7e-04 SB_23641| Best HMM Match : DUF837 (HMM E-Value=0.37) 38 0.005 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 37 0.011 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 36 0.026 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 35 0.035 SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) 35 0.035 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 34 0.060 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 34 0.080 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) 33 0.18 SB_45938| Best HMM Match : Troponin (HMM E-Value=1) 33 0.18 SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) 32 0.24 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 32 0.24 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_24887| Best HMM Match : PspA_IM30 (HMM E-Value=0.19) 32 0.24 SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_8589| Best HMM Match : DUF164 (HMM E-Value=0.29) 32 0.32 SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 32 0.32 SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 31 0.43 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 31 0.43 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 30 0.98 SB_4107| Best HMM Match : M (HMM E-Value=8e-22) 30 0.98 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 30 1.3 SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) 30 1.3 SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) 30 1.3 SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_19861| Best HMM Match : DUF465 (HMM E-Value=6.1) 30 1.3 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 30 1.3 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 30 1.3 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 30 1.3 SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) 29 1.7 SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) 29 1.7 SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_15201| Best HMM Match : Tropomyosin (HMM E-Value=0.24) 29 1.7 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_31348| Best HMM Match : ERM (HMM E-Value=0) 29 1.7 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 29 1.7 SB_5515| Best HMM Match : PspA_IM30 (HMM E-Value=0.14) 29 1.7 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) 29 2.3 SB_19380| Best HMM Match : DUF827 (HMM E-Value=0.06) 29 2.3 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 29 2.3 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 29 2.3 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_26444| Best HMM Match : CAP_GLY (HMM E-Value=1.2e-23) 29 2.3 SB_28543| Best HMM Match : DUF1337 (HMM E-Value=2.4) 29 3.0 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 29 3.0 SB_39000| Best HMM Match : TolA (HMM E-Value=0.55) 29 3.0 SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) 29 3.0 SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_50756| Best HMM Match : S-antigen (HMM E-Value=2.4e-09) 28 5.3 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 28 5.3 SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) 28 5.3 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_23665| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_21610| Best HMM Match : HSF_DNA-bind (HMM E-Value=0.32) 28 5.3 SB_20144| Best HMM Match : E-MAP-115 (HMM E-Value=0.41) 28 5.3 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 27 6.9 SB_44354| Best HMM Match : APC_15aa (HMM E-Value=0.88) 27 6.9 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_27059| Best HMM Match : APC_15aa (HMM E-Value=0.88) 27 6.9 SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_19173| Best HMM Match : Ribosomal_L34 (HMM E-Value=5.2) 27 6.9 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_54| Best HMM Match : Actin (HMM E-Value=0) 27 6.9 SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_45286| Best HMM Match : GRIP (HMM E-Value=3.6e-08) 27 6.9 SB_28230| Best HMM Match : Hormone_3 (HMM E-Value=6.3) 27 6.9 SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) 27 6.9 SB_17814| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_6447| Best HMM Match : DUF164 (HMM E-Value=0.48) 27 6.9 SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) 27 6.9 SB_2494| Best HMM Match : M (HMM E-Value=0.0056) 27 6.9 SB_58977| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 27 9.2 SB_41836| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.5e-07) 27 9.2 SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) 27 9.2 SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) 27 9.2 SB_21673| Best HMM Match : Troponin (HMM E-Value=0.34) 27 9.2 SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06) 27 9.2 SB_48386| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_34623| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_30634| Best HMM Match : Apolipoprotein (HMM E-Value=0.16) 27 9.2 SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 132 bits (318), Expect = 2e-31 Identities = 64/170 (37%), Positives = 98/170 (57%) Frame = +2 Query: 2 GYLSRKEYKKLQEQRLALQVVQRNLRKYLQLRTWPWWKLWQKVKPLLNVTRIEDEIXXXX 181 G+L RKEY+K+ +QR+ + V+QRN+RKYL LR W WWKL+ +VKPLL V R ++E+ Sbjct: 785 GFLMRKEYRKMCDQRIGISVIQRNVRKYLYLRNWAWWKLYTRVKPLLQVARADEEMKQKV 844 Query: 182 XXXXXXXXXXXXXXXXRKEVXXXXXXXXXXXXXXXXXXXGNQGSLAETQERANKLQAQKA 361 RKE+ Q + A+ +ER +L+ +KA Sbjct: 845 EQMKEIEEKLGKEEALRKELEEKYTKLVEEKNLLFQDFQREQDACADAEERNAELEGRKA 904 Query: 362 DLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQK 511 DLE Q++D ++L EE+A +L K KLE E+S LK+D+E+L+ +++K Sbjct: 905 DLEAQVKDMLEQLEDEEEASAELSSVKHKLEGEISDLKQDIEELDATLKK 954 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/57 (35%), Positives = 36/57 (63%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 E ++ +LQA ++ +E + D +L ++E+ QL +AKK LEQ++ LKK ++D Sbjct: 1301 ELRKNIQELQAIRSRIEAENADVNRQLEEQENKGGQLGKAKKNLEQQLEELKKQLDD 1357 Score = 36.7 bits (81), Expect = 0.011 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = +2 Query: 317 AETQERANKL-QAQKA--DLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 AE ++ N+L QA +A + + D DRL + + N L Q K+KLE +V+ ++++++ Sbjct: 1719 AELEDLRNQLEQADRARRTADQERADAVDRLAEVSNQVNNLQQGKRKLEGQVNTMQEELD 1778 Query: 488 DLE 496 D E Sbjct: 1779 DAE 1781 Score = 32.3 bits (70), Expect = 0.24 Identities = 16/58 (27%), Positives = 31/58 (53%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 L + E KLQ K +E++ + +D L +E++ + L + K KLE + + ++E Sbjct: 973 LQQQDEAIAKLQKAKKQVEDERTELEDHLQEEQNKVSHLTKTKLKLESTLDEVNLNLE 1030 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +2 Query: 371 NQLRDTQDRLTQE-EDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQ 508 N +R Q++ QE ++ +Q+ + K KLE+E + L + +DL ++V+ Sbjct: 1226 NSMRSKQNQQMQEMQEELDQVKKTKAKLEKEKAQLTNEGDDLAVTVE 1272 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 101 bits (242), Expect = 4e-22 Identities = 56/170 (32%), Positives = 86/170 (50%) Frame = +2 Query: 2 GYLSRKEYKKLQEQRLALQVVQRNLRKYLQLRTWPWWKLWQKVKPLLNVTRIEDEIXXXX 181 G ++RK+Y K +Q A++V+QRN YL+LR W WW+L+ KVKPLLNVTR E+E+ Sbjct: 830 GNIARKQYHKRVQQLSAIRVIQRNCLSYLKLRNWQWWRLFTKVKPLLNVTRQEEELHQRE 889 Query: 182 XXXXXXXXXXXXXXXXRKEVXXXXXXXXXXXXXXXXXXXGNQGSLAETQERANKLQAQKA 361 ++ + ET+E +LQ +K Sbjct: 890 DELRTLREKLEKLETEYTDLEKKHSQISEEKAIVAEQLESEREVAQETEEMRQRLQTKKN 949 Query: 362 DLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQK 511 +LE L D + R+T+EE+ L + KKKL +E+ L+ +E+ E + QK Sbjct: 950 ELEELLSDLEGRITEEEENVLALTEDKKKLLKEIQDLEDSLEEEESARQK 999 Score = 33.1 bits (72), Expect = 0.14 Identities = 16/70 (22%), Positives = 40/70 (57%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 Q SL E + ++ D+EN++ Q++L +EE+ ++ L + + + + + +KK V Sbjct: 1246 QDSLQEETHHKLMIISKLKDVENEIVSLQEQLEEEEENKSALQKQLQSAQTQCAEMKKVV 1305 Query: 485 EDLELSVQKS 514 E+ +++++ Sbjct: 1306 EERAAALEEA 1315 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 44.0 bits (99), Expect = 7e-05 Identities = 22/67 (32%), Positives = 38/67 (56%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 L+E ++ +LQA KA LE QL+ + L D ++ Q + + + E+ G+K+ + D Sbjct: 1487 LSEKEDSVGQLQAGKAYLEEQLQSMKVSLVLSRDDSEKIKQDQSRYQNEILGIKEALSDA 1546 Query: 494 ELSVQKS 514 E VQK+ Sbjct: 1547 ETRVQKT 1553 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 40.7 bits (91), Expect = 7e-04 Identities = 18/69 (26%), Positives = 39/69 (56%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKD 481 NQ A+ +E N+L +K +L ++ DT+ RL Q+++A + ++ + GL++ Sbjct: 1710 NQKKTADLEEAVNRLVTEKQNLAEEVDDTRHRLDQQKEANMANERELMEIRSAIEGLERV 1769 Query: 482 VEDLELSVQ 508 +ED + ++ Sbjct: 1770 LEDKDSQIE 1778 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +2 Query: 308 GSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 G L + N LQ +K ++++ D Q L+ ++ K KLE L+K + Sbjct: 2314 GKLKNNENTINILQEEKNKSQDKILDLQKELSSRTHELQKVSSEKGKLEAAFDILQKKYD 2373 Query: 488 DL 493 DL Sbjct: 2374 DL 2375 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/68 (26%), Positives = 31/68 (45%) Frame = +2 Query: 308 GSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 G + T E K + ++ QLR L +E D+ ++ K+ +++ + VE Sbjct: 728 GEVKRTAENLRKDLEGRDEVIKQLRPKVKELLEENDSLKVELESLKQSYEDLEEQYRVVE 787 Query: 488 DLELSVQK 511 D LS QK Sbjct: 788 DKYLSAQK 795 >SB_23641| Best HMM Match : DUF837 (HMM E-Value=0.37) Length = 201 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/57 (29%), Positives = 34/57 (59%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 E +E+ + + ++ E L+ T DRLT+ DARN+ +A +K E+ +++ V++ Sbjct: 97 EIEEQGLRREKEREYHEGVLQQTADRLTEVNDARNEALEALRKHRAELMSMRERVQE 153 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 37.9 bits (84), Expect = 0.005 Identities = 19/65 (29%), Positives = 37/65 (56%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 LA+ + + KL +K DL+ L T+ L +EE +L + + L+ E+ LKK++ L Sbjct: 1509 LADVRAQREKLNVEKNDLKVSLHKTKSHLAEEEMENEKLVKENEILKVELEQLKKEMMAL 1568 Query: 494 ELSVQ 508 ++ ++ Sbjct: 1569 KVEME 1573 Score = 37.1 bits (82), Expect = 0.009 Identities = 19/65 (29%), Positives = 34/65 (52%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 L + + L +K DL ++ D + R+T+ E N L K+ LEQ+V+ + + +L Sbjct: 247 LVSVNAKNDLLNQEKKDLVKKINDLKKRITELELIINTLKDEKEALEQDVNSMSYKISNL 306 Query: 494 ELSVQ 508 E V+ Sbjct: 307 ETKVK 311 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = +2 Query: 341 KLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 K K LE + + + RL ED N+ + K+K E + LKK + DLE+ Sbjct: 1602 KRDRDKYQLEKE--EAEKRLQSYEDELNEKQKQKEKAEDNLKALKKRISDLEV 1652 Score = 28.7 bits (61), Expect = 3.0 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 7/56 (12%) Frame = +2 Query: 359 ADLENQLRDTQ---DRLTQE---EDARNQLF-QAKKKLEQEVSGLKKDVEDLELSV 505 ADL QL++ + + L +E +A+N L Q KK L ++++ LKK + +LEL + Sbjct: 227 ADLMQQLKEAEADVESLRRELVSVNAKNDLLNQEKKDLVKKINDLKKRITELELII 282 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 7/63 (11%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQ---DRLTQE----EDARNQLFQAKKKLEQEVSGLKK 478 E + + +++ + L+NQL+D + + L E E + N L + KK LE E++ LK Sbjct: 326 ELEAKNRRMKNEILQLQNQLKDKERMCENLAAEAKQLEASNNALKRDKKALEDEINLLKM 385 Query: 479 DVE 487 +E Sbjct: 386 QLE 388 Score = 27.9 bits (59), Expect = 5.3 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 4/68 (5%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRD--TQDRLTQEE-DARNQLFQAK-KKLEQEVSG 469 N+ ++ +E ANKL K +LEN++ + Q +L E + N L ++ K LE Sbjct: 1945 NEKEISHLEEDANKLGEDKNELENKIIELTNQYKLKLAELENENDLRNSRVKNLENLCKK 2004 Query: 470 LKKDVEDL 493 +K +++L Sbjct: 2005 YEKQIQEL 2012 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 36.7 bits (81), Expect = 0.011 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = +2 Query: 317 AETQERANKL-QAQKA--DLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 AE ++ N+L QA +A + + D DRL + + N L Q K+KLE +V+ ++++++ Sbjct: 23 AELEDLRNQLEQADRARRTADQERADAVDRLAEVSNQVNNLQQGKRKLEGQVNTMQEELD 82 Query: 488 DLE 496 D E Sbjct: 83 DAE 85 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 35.5 bits (78), Expect = 0.026 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 E E++ +L+ + D+ N R Q+ L+ +D++ L Q K EQE+ L +DLE Sbjct: 93 ELHEKSERLRVTEEDVSNLQRAIQE-LSLHKDSKESLIQQLMKKEQEIERLTTKCKDLE 150 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 35.1 bits (77), Expect = 0.035 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDR-LTQEEDARNQLFQAK-KKLEQEVSGLKK 478 Q +AE QER K+Q Q +LE + R+ ++R QEE+ R + Q + ++ ++E K+ Sbjct: 589 QQKIAEEQERLRKIQEQ-MELERKRREEEERKRKQEEEERKRKMQMELQRRKEEEEQKKR 647 Query: 479 DVED 490 D E+ Sbjct: 648 DEEE 651 >SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) Length = 306 Score = 35.1 bits (77), Expect = 0.035 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 Q ++ T E ++ ++ +LE +L Q + + ED L + K ++E E+S +K+D Sbjct: 241 QENIRRTDEELQGVKRERVELEGRLSSLQRKNEELEDELATLRRKKLEVEDEISAIKRDK 300 Query: 485 ED 490 D Sbjct: 301 AD 302 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 34.3 bits (75), Expect = 0.060 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +2 Query: 344 LQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLK 475 L+ Q + Q+ + DRL QE + RN++ A K+ +QE+S K Sbjct: 2587 LEQQINNYRRQIEELSDRLRQEMETRNRIELANKQQQQELSSAK 2630 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 34.3 bits (75), Expect = 0.060 Identities = 17/63 (26%), Positives = 39/63 (61%) Frame = +2 Query: 308 GSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 G A++ ++ + L+ +KA++E+ L + +L++ EDA + + K + + E+S LK+ + Sbjct: 1 GDKADSDDQVSYLKKEKAEVEHGLVAAKRKLSELEDAISANKREKMEKDHEISLLKRTTD 60 Query: 488 DLE 496 L+ Sbjct: 61 TLQ 63 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 329 ERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 E N + LEN L+D ++ + + ++ R L + K L +EV+ K V L+ Sbjct: 203 ELKNAEKKGSRQLENMLKDHEEEVRRMKEERKDLCEEIKALREEVNEFKARVSHLK 258 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 34.3 bits (75), Expect = 0.060 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +2 Query: 320 ETQERANK-LQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 E +++ NK L+ Q+ L NQ+ D + +L++ E KK +E EV L++ VED E Sbjct: 2665 EIKDKENKNLELQR--LTNQIEDFKTKLSEVEGRVKAANSEKKTIEDEVKKLRETVEDKE 2722 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +2 Query: 305 QGSLAETQERA-NKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKD 481 +G + TQ R K + D +R DR+ E+ RNQL + E ++ ++ Sbjct: 2288 EGVDSTTQSREMQKTEVMPLDRSEVMRANLDRIVALEEERNQLKNELRLSEDKLHEAEQK 2347 Query: 482 VEDLELSVQK 511 E LE+++ + Sbjct: 2348 FEKLEVALSQ 2357 Score = 28.7 bits (61), Expect = 3.0 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 10/69 (14%) Frame = +2 Query: 329 ERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLE----------QEVSGLKK 478 +R L+ ++ L+N+LR ++D+L + E +L A +LE + V LKK Sbjct: 2318 DRIVALEEERNQLKNELRLSEDKLHEAEQKFEKLEVALSQLESISEVFHSGTENVDALKK 2377 Query: 479 DVEDLELSV 505 ++ D + S+ Sbjct: 2378 EIRDRDKSI 2386 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 AE + LQA K +E QL + ++++ +D L ++ + +QE+ L+ + +LE Sbjct: 1341 AEKDNLTDNLQASKEYIEGQLESLKAQMSKIKDENENLKESDARRQQEILDLENRINELE 1400 Score = 31.5 bits (68), Expect = 0.43 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +2 Query: 341 KLQAQKADLENQLRDTQD---RLTQE-EDARNQLFQAKKKLEQ 457 + Q Q ADLEN+L+D ++ RL E +D RN+L AK + E+ Sbjct: 2307 RAQPQIADLENKLQDAREQNSRLKIEIDDLRNKLSSAKSRYER 2349 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 344 LQAQK--ADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSV 505 L+A K AD E++L+ T+D L + ++ + + +LE K+ DLE V Sbjct: 592 LEANKRAADAEDELQQTEDELNRLKNDIQEKEKRISELESAFDAADKEKRDLEQQV 647 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 Q ++E + + + +LE ++R ++R+T+ E +L + K LEQ+V +K Sbjct: 393 QKVVSELKIKLERFSEDGTELEEKIRSQRNRITELERRVKELEKEKNLLEQQVKTMKNKS 452 Query: 485 ED 490 +D Sbjct: 453 DD 454 >SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) Length = 1136 Score = 32.7 bits (71), Expect = 0.18 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = +2 Query: 347 QAQKADLENQLRDTQDRLTQEE----DARNQLFQAKKKLEQEVSGLKKDVEDLELSVQKS 514 +A + LE +L + QE+ D N L + L++ +SGLKK VE+LE S+ + Sbjct: 9 EATRQKLEYELALSHKAANQEKRSASDRENHLQKTNASLKEIISGLKKQVEELENSLNSN 68 >SB_45938| Best HMM Match : Troponin (HMM E-Value=1) Length = 185 Score = 32.7 bits (71), Expect = 0.18 Identities = 15/70 (21%), Positives = 39/70 (55%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 + LAE + ++L++++ D+E +++D + +L+ E +L + E +K++V Sbjct: 64 ENKLAEAKAYNDQLESEREDMEYKVKDIKKKLSNERQRVEELEDELTSKKFEKDSIKQEV 123 Query: 485 EDLELSVQKS 514 E L ++ ++ Sbjct: 124 ELLSATLSET 133 >SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) Length = 824 Score = 32.3 bits (70), Expect = 0.24 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 E Q+ + L+ +K +L+ QLRD+Q+ L + +D L + QE SGL +E Sbjct: 240 ELQDEVDALRQRKDELKTQLRDSQEELEKTKDGLRSL----RSKWQEKSGLITQME 291 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 32.3 bits (70), Expect = 0.24 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRD---TQDRLTQEEDARNQLFQAKKKLEQEVSGL 472 NQ + +E KL AQKADLE + + Q L QE + K LE+ L Sbjct: 266 NQKLELKDKELEEKLLAQKADLEKVIAEKEAQQKELQQELSIHKSATEKLKDLEENEKRL 325 Query: 473 KKDVEDLELSVQK 511 V++L+ ++K Sbjct: 326 VTSVQELQSLMEK 338 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 32.3 bits (70), Expect = 0.24 Identities = 16/63 (25%), Positives = 32/63 (50%) Frame = +2 Query: 308 GSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 G E A ++ + + + D + T ED+ Q F+A K+L++E++ L+ +E Sbjct: 656 GRSLEVAREAPDNESDSSSVSGEEEDRRLEDTWHEDSGKQEFEAVKELDREINTLRSSIE 715 Query: 488 DLE 496 + E Sbjct: 716 ESE 718 >SB_24887| Best HMM Match : PspA_IM30 (HMM E-Value=0.19) Length = 320 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/66 (27%), Positives = 34/66 (51%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 +++ E+ L E QLR+T+ RL ++ +L K ++++ GL+ +EDL Sbjct: 102 VSQKDEKIAVLSTNHDFKEKQLRETESRLEDFKNEVKKLQHTIKLKDKKIDGLESRLEDL 161 Query: 494 ELSVQK 511 E + K Sbjct: 162 ESANNK 167 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = +2 Query: 299 GNQGSLAETQERANKLQAQKADLENQLRDTQDRLTQEED---ARNQLFQAKKKLEQEVSG 469 G + L + + NKL E ++ D + ++ + E +N+L Q+ ++ +++ Sbjct: 153 GLESRLEDLESANNKLHHSLKFKEEKISDLEGQIDELESLAAEKNRLSQSLEQKMKKIME 212 Query: 470 LKKDVEDLELSVQK 511 L+ VEDL Q+ Sbjct: 213 LENRVEDLTCETQR 226 >SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1401 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = +2 Query: 341 KLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 +LQA+ A+ E QLRD L++ + + QA +L++E++ L K +LE Sbjct: 4 ELQARLAETEQQLRDA---LSEYDSLKRDYDQAMAQLQEEIAALDKMQAELE 52 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +2 Query: 344 LQAQKADLENQLRDTQDRLTQE-EDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQKS 514 L+ Q DLE L QDRL + ++A QL + + + GL+ +++ + +QK+ Sbjct: 523 LEGQIKDLEGGLARAQDRLDKTLDNAETQLDRERSASAARIRGLEDELDRMAEKLQKA 580 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQE 460 LA+T+ R L++ +A++E +LRD DRL Q+ A + + + + EQE Sbjct: 213 LADTKAR---LKSAEAEIE-KLRDAIDRLKQQNQADRRAAEDRIRKEQE 257 >SB_8589| Best HMM Match : DUF164 (HMM E-Value=0.29) Length = 306 Score = 31.9 bits (69), Expect = 0.32 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +2 Query: 311 SLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 S A+ QE+ ++ ++ L ++ T + +L KK +E E SGLK V+D Sbjct: 87 SSAKLQEQRIHVEEERNSLLKEIEGTVTEIQNHVLNARELEIEKKAIESECSGLKNQVQD 146 Query: 491 LELSVQKS 514 L + K+ Sbjct: 147 LRKLLGKT 154 >SB_3044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 31.9 bits (69), Expect = 0.32 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +2 Query: 311 SLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 S A+ QE+ ++ ++ L ++ T + +L KK +E E SGLK V+D Sbjct: 87 SSAKLQEQRIHVEEERNSLLKEIEGTVTEIQNHVLNARELEIEKKAIESECSGLKNQVQD 146 Query: 491 LELSVQKS 514 L + K+ Sbjct: 147 LRKLLGKT 154 Score = 31.9 bits (69), Expect = 0.32 Identities = 14/64 (21%), Positives = 35/64 (54%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 E + L+ + DL+N+ + +T+ + + ++ + +KLE+E L ++ D ++ Sbjct: 467 EELKDVESLKKDREDLKNECLALSETVTKIANEKREMEKEIEKLEEENKKLVSEINDFKV 526 Query: 500 SVQK 511 ++QK Sbjct: 527 NIQK 530 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 31.9 bits (69), Expect = 0.32 Identities = 20/62 (32%), Positives = 32/62 (51%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 + QE +K++ Q+ LE Q T T E+ +L +AK + E +SG KD+E Sbjct: 494 QIQELQSKIRQQQEQLEQQREITDTVSTDLEEKAKELEEAKSENEA-ISGKMKDMESQLT 552 Query: 500 SV 505 S+ Sbjct: 553 SI 554 >SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 31.5 bits (68), Expect = 0.43 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 7/64 (10%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDA-------RNQLFQAKKKLEQEVSGLKK 478 +TQE+ ++++ +K +++ R TQ++L E QL KK LE E LK Sbjct: 324 QTQEKEDEMEGEKKNMQEHTRQTQEKLQTSETIIKGLRADIKQLEIVKKTLEVEKGQLKS 383 Query: 479 DVED 490 ED Sbjct: 384 ICED 387 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 31.5 bits (68), Expect = 0.43 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +2 Query: 311 SLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKL-EQEVSGLKKDVE 487 +LA Q A K QA + + +L+D +EE A+ +L AK+K E+ S + E Sbjct: 1119 ALARAQAEA-KQQAIEEEKAKRLQDEDQARREEEQAQEKLKDAKRKAREERESRRAAEAE 1177 Query: 488 DLELSVQK 511 L VQK Sbjct: 1178 RRRLEVQK 1185 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 31.5 bits (68), Expect = 0.43 Identities = 16/55 (29%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +2 Query: 338 NKLQAQKADLENQLRDTQDRLTQEEDARNQ--LFQAKKKLEQEVSGLKKDVEDLE 496 +++ +K DL N++++ Q+RL E DA+ Q L A + + + L++ ++LE Sbjct: 2128 DQVSTEKEDLANRVKELQERLGVETDAKTQALLESALGEYQDHIDMLERKSKELE 2182 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 31.5 bits (68), Expect = 0.43 Identities = 14/53 (26%), Positives = 34/53 (64%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKK 478 + + + L+++K +E++L+DT+ RLTQ + +L +A+ ++ Q+ ++K Sbjct: 1730 DAERKYGTLKSEKGKIEDELKDTKKRLTQYQ---TELNEARTEIRQKDDVIRK 1779 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRD-TQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 A Q++ + ++ +K DLENQ+ + R TQE+ +L KK++E +++ +DL Sbjct: 1522 ASLQDQISDMEQKKDDLENQVTGLSSQRNTQEK----ELGLLKKRMEYTEEEIRRTEQDL 1577 Query: 494 ELSVQK 511 ++ Sbjct: 1578 SRKAEQ 1583 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 31.1 bits (67), Expect = 0.56 Identities = 18/71 (25%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKA-DLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKK 478 NQ + + K +K +LE+ R +++ T+EE+ NQ+++ K+ +EV+ LK+ Sbjct: 74 NQRDWSNLKTELEKSHREKIHELESSYR--KEKSTREEEFDNQMWELKQGHSKEVASLKQ 131 Query: 479 DVEDLELSVQK 511 + E + +++ Sbjct: 132 NFEQQKTELEQ 142 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 31.1 bits (67), Expect = 0.56 Identities = 17/59 (28%), Positives = 34/59 (57%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 AE +E + L+ +++ E ++DTQ L++ + A + + K++L + LKK E+L Sbjct: 1095 AEIKELGSLLETEQSSHEKTIKDTQKHLSRMDRADKENSELKQELALLKTKLKKVKEEL 1153 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 30.7 bits (66), Expect = 0.74 Identities = 13/56 (23%), Positives = 29/56 (51%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 E +++ + + + DL N LRD D E + +L++E++ +KK+++ Sbjct: 1005 EIKQKEKQSKEKDEDLHNNLRDLSDERQTSELKVRDILNENNQLKKELTSVKKELD 1060 Score = 28.3 bits (60), Expect = 4.0 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 4/72 (5%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQE----VSG 469 +Q L E +E+A +K DLE + D+L ++E++ ++L Q + EQE ++ Sbjct: 1385 SQNRLLE-REKAEADLKEKFDLEEKA--LLDKLAEKENSEHELMQRIESTEQENQAKLNQ 1441 Query: 470 LKKDVEDLELSV 505 K +E+L+ S+ Sbjct: 1442 KDKSIEELQASL 1453 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 30.7 bits (66), Expect = 0.74 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 2 GYLSRKEYKKLQEQRLALQVVQRNL 76 G+L+RK KKLQ Q A+ +QRN+ Sbjct: 1790 GFLARKRLKKLQVQNKAMICIQRNI 1814 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQE 460 Q + + Q + + Q+ + E Q R+ ++ Q+E R QL K++ EQ+ Sbjct: 625 QEQMLQRQREEEERRRQQEEAERQRREQEEVFKQQEQQRQQLELQKRQQEQQ 676 >SB_4107| Best HMM Match : M (HMM E-Value=8e-22) Length = 2039 Score = 30.3 bits (65), Expect = 0.98 Identities = 19/69 (27%), Positives = 37/69 (53%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 Q L + +E +L A+ L+ + R+ Q+RL + + + Q K++LE+ L+KD Sbjct: 1745 QQILRQQKEAEEELVARIGKLQEEKRELQERLAKFQRSVAAAEQEKRELERAHVRLEKDK 1804 Query: 485 EDLELSVQK 511 + L ++ K Sbjct: 1805 KALRNTLDK 1813 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/59 (23%), Positives = 28/59 (47%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 + E +E + + DL+ QL+D + N+L KK E E + L++ +++ Sbjct: 1101 IREGEEAREVARKENTDLKRQLKDEEREKDAVSHTANELRGKVKKSEAEKTNLRRQLDE 1159 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 30.3 bits (65), Expect = 0.98 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 8/74 (10%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRD--------TQDRLTQEEDARNQLFQAKKKLEQE 460 Q L ++ N LQA+ + LE + + QDR+++ +D +++ KL++ Sbjct: 887 QVQLKAKDDKVNNLQAKISKLEADMNEQQASKDITAQDRVSELKDLLKVSRESESKLQER 946 Query: 461 VSGLKKDVEDLELS 502 + L++ + LEL+ Sbjct: 947 IESLREKITGLELA 960 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/54 (25%), Positives = 31/54 (57%) Frame = +2 Query: 353 QKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQKS 514 QK+ ++L+ T D L D+ ++L + K+K++Q+ +++D +QK+ Sbjct: 783 QKSQTVDELKSTMDTLM---DSASKLEEDKRKIQQQADKRVSEMQDSITGIQKT 833 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 30.3 bits (65), Expect = 0.98 Identities = 20/66 (30%), Positives = 40/66 (60%), Gaps = 6/66 (9%) Frame = +2 Query: 317 AETQERANK---LQAQKADLEN--QLRDTQDRLTQEEDARNQLFQAKKKLEQEV-SGLKK 478 AET RA + L+ +K LE +L++ +D++ +EE + + + K+KL+ ++ +K Sbjct: 265 AETNARALQEKLLEEEKKRLEELERLKEEKDKMLEEELKKRETLEEKQKLQDKILEEERK 324 Query: 479 DVEDLE 496 +E+LE Sbjct: 325 RLENLE 330 >SB_25829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 30.3 bits (65), Expect = 0.98 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 83 YLQLRTWPWWKLWQKVKPLLNVTRI 157 Y QL+ WP+ +W K+ P L +T I Sbjct: 102 YFQLQYWPFGLVWCKMLPTLQITNI 126 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLT----QEEDARNQLFQAKKKLEQEVSGLKKD 481 L ++E N+ Q +++ ++ + R+T Q +D ++ Q K+KL + GL + Sbjct: 1743 LGTSRESDNQGDKQNSEMSARINSLEKRITTLQGQAQDKDEEIAQLKRKLNEYSDGLGQG 1802 Query: 482 VEDLE 496 +D+E Sbjct: 1803 SKDIE 1807 >SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) Length = 311 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQ----EEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 Q +L K DLE L++ ++++ EE+ RN + + +K+LE ++D E L Sbjct: 198 QSEVERLARMKEDLEEDLQEKENQMDHWKVLEEELRNGINEREKELEMLRCSTEEDQEKL 257 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/66 (28%), Positives = 36/66 (54%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 LAE E +KL+ E +L Q + EDA + +AKK++EQ ++ + + ++ Sbjct: 40 LAELGESKSKLRRA----EKELNTLQHNVQIAEDACKEKEKAKKQMEQRMAEIGVEKGNV 95 Query: 494 ELSVQK 511 E S+++ Sbjct: 96 ERSLEE 101 >SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1312 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +2 Query: 323 TQERANKLQAQKADLENQLRDTQDRLTQE-EDARNQLFQAKKKLEQEVSGLKK 478 T E +NK + A L N+L++TQ L + + + +L ++K+ +E LKK Sbjct: 687 TVEESNKALEEVASLRNKLQETQRMLIESTRNWQEKLALSEKRKLEEAENLKK 739 >SB_30512| Best HMM Match : GLTT (HMM E-Value=0.00058) Length = 1083 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGL 472 L T E+ L+ + ADL + +TQ+ ++ + L + K+ LE+ + L Sbjct: 279 LQHTSEKYKLLEKENADLRQSVSETQEVANSLQNRNSLLEREKQSLEENIQDL 331 >SB_26151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 7/64 (10%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQEED----ARNQLFQA---KKKLEQEVSGLKKDV 484 Q + + L QKA LE QLRD++ + +D + QL + K L +E+S K + Sbjct: 110 QSQIDNLSKQKASLEEQLRDSKGETKKYQDDLLNTKRQLAETEWEKGSLTRELSSSKSII 169 Query: 485 EDLE 496 E ++ Sbjct: 170 EKMK 173 >SB_19861| Best HMM Match : DUF465 (HMM E-Value=6.1) Length = 75 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 311 SLAETQERAN-KLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQ 457 SL T E N KL AQ+ L+ + + +DRL E +A N+L K +L Q Sbjct: 13 SLQMTHEELNIKLSAQEKALK-AMTEERDRLKSENEAMNELSAKKIQLAQ 61 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 329 ERANKLQAQKADLENQLRDTQDRLTQEEDA-RNQLFQAKKKLEQEVSGLKKDVEDL 493 E ++ QK+D + +LRD + + + DA R ++ + L+ ++ LK V +L Sbjct: 162 ELRGSMEKQKSDFQTELRDMKRDMEDKLDAQRVEMVYKESTLQNQIEELKVQVSEL 217 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/71 (22%), Positives = 37/71 (52%) Frame = +2 Query: 299 GNQGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKK 478 G G L +E QA++A Q+R +D+ QE+ + + + +K++E + LK Sbjct: 337 GKDGELRMLKESLAHFQAEEAKKREQIRAMEDQRKQEQSEKEK--ELQKQVEHLTTRLKF 394 Query: 479 DVEDLELSVQK 511 +++ ++++ Sbjct: 395 QEQEIAQAMEQ 405 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 311 SLAETQERAN-KLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQ 457 SL T E N KL AQ+ L+ + + +DRL E +A N+L K +L Q Sbjct: 845 SLQMTHEELNIKLSAQEKALK-AMTEERDRLKSENEAMNELSAKKIQLAQ 893 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/78 (25%), Positives = 43/78 (55%), Gaps = 7/78 (8%) Frame = +2 Query: 299 GNQGSLAETQERANKLQAQKADLENQLRDTQDRLTQEE----DARNQLFQAK---KKLEQ 457 G QG++ +E +N+LQ + DLE++ ++ + + E A L +A+ K E Sbjct: 3071 GYQGNIKSLEENSNRLQERIKDLEDENLESHKKASSLECELSTANENLKEAQNNCKDAEI 3130 Query: 458 EVSGLKKDVEDLELSVQK 511 EVS L++++ + ++++ Sbjct: 3131 EVSKLREEIIESHKTIKE 3148 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/64 (17%), Positives = 34/64 (53%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 AE +K++ +K D+ N+L + +++ + E+ L + + + ++ +++DL+ Sbjct: 3709 AELTHENDKIRQEKDDIANELMNLKEKFAKVEEEYRVLVKDTESINRDKQTTVSELDDLK 3768 Query: 497 LSVQ 508 ++ Sbjct: 3769 AKIR 3772 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 4/65 (6%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEE----DARNQLFQAKKKLEQEVSGLKKD 481 L + QE A K + + + ++ D Q + ++E D +++L + ++ ++ GLKKD Sbjct: 3564 LKDDQELARKQRQEVIEKGREIEDLQSKFKRKEREVEDLKHRLLRETEQEKKLHDGLKKD 3623 Query: 482 VEDLE 496 + + E Sbjct: 3624 LYEAE 3628 >SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) Length = 599 Score = 29.5 bits (63), Expect = 1.7 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQD--RLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 +AE ++R + L Q+ + E + R + R EE+AR Q + + + QE KKD E Sbjct: 367 MAEAKQREHVLWRQRKEEEERARREMEARRRKGEEEARRQKERELEAMRQEQERQKKDQE 426 >SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) Length = 867 Score = 29.5 bits (63), Expect = 1.7 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 7/69 (10%) Frame = +2 Query: 326 QERANKLQAQKADLEN-QLRDTQDRLTQEEDARN------QLFQAKKKLEQEVSGLKKDV 484 QE N+L + +LEN + + D T EE+ N +L + K KLE+E +K+ Sbjct: 496 QEVVNRLLEEIKELENFEEEELPDVTTLEEEVVNITQQIAELKEQKTKLEEEFEAIKEKH 555 Query: 485 EDLELSVQK 511 + EL Q+ Sbjct: 556 QKQELKKQR 564 >SB_26831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 29.5 bits (63), Expect = 1.7 Identities = 24/77 (31%), Positives = 44/77 (57%), Gaps = 11/77 (14%) Frame = +2 Query: 314 LAETQERANK-LQAQKADLEN--QLRDTQDRLTQE-----EDARNQLFQAKKKLEQE--- 460 L ET+E + +Q K +LEN ++ +D QE ++A N+L +K++ ++ Sbjct: 736 LIETKETSEAHVQQLKENLENGQEVLKRKDTTIQEISSALKEAENKLSGVEKQMAEKSSS 795 Query: 461 VSGLKKDVEDLELSVQK 511 ++ L+ VEDLE S+Q+ Sbjct: 796 INALELKVEDLEASIQE 812 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/58 (22%), Positives = 33/58 (56%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 AE +E + + ++ + E + R+ ++R +EE+ + + + +K+ E+E K+ E+ Sbjct: 440 AEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKEEE 497 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/56 (21%), Positives = 33/56 (58%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 E +ER + + ++ + E + R+ +++ +EE+ + + + +K+ E+E +K+ E Sbjct: 449 EEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKEEEKKRKEEE 504 >SB_15201| Best HMM Match : Tropomyosin (HMM E-Value=0.24) Length = 253 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/70 (22%), Positives = 42/70 (60%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 +GS+ +ER LQA+ + EN+ R+ E + +NQ + + + +Q++ +++ + Sbjct: 14 KGSIKSFKERTAVLQAELKEYENKRREF------EIETKNQRVR-ESRAKQQMQRMRQRM 66 Query: 485 EDLELSVQKS 514 +D+++ ++K+ Sbjct: 67 QDIDVKMEKN 76 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 29.5 bits (63), Expect = 1.7 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +2 Query: 341 KLQAQKADLENQLRDTQDRLTQEE-DARNQLFQAKKKLEQEVSGLKKDVEDLELSVQK 511 KL + +LEN +D + ++ QE+ D + K+ E E+ LK ++EDLE +K Sbjct: 563 KLSEMEKELENS-KDEKVKIEQEKADLDIAIENLKRNQEIELEELKDNIEDLERENKK 619 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/60 (21%), Positives = 34/60 (56%) Frame = +2 Query: 332 RANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQK 511 R NK+ L+ ++ D +T+ + ++L + KKK++ + L+ ++DL++ +++ Sbjct: 374 RVNKIN----QLDKEVIDMGGEITKIKKPNDELRKTKKKMQVQYEKLEHQLDDLKVQLKR 429 >SB_31348| Best HMM Match : ERM (HMM E-Value=0) Length = 665 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/69 (21%), Positives = 35/69 (50%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 Q + E + +LQA+ +L+N+ ++ L + E+ L + + E+E + L++ Sbjct: 156 QQAREEAIRQKEELQARLQELQNEADSCREALMRSEETAELLAEKARVAEEEATLLQRKA 215 Query: 485 EDLELSVQK 511 D E +++ Sbjct: 216 TDAEEELRR 224 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +2 Query: 407 EEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 EE+ N+L + KK LE+EV L+++ E+L+ Sbjct: 1797 EEEMNNRLAREKKPLEEEVRELQEENEELK 1826 >SB_5515| Best HMM Match : PspA_IM30 (HMM E-Value=0.14) Length = 388 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +2 Query: 344 LQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 LQA+ +L N+L+ +R+ +D ++ K +L E+ G +K E Sbjct: 151 LQAELDNLNNELKAKDNRIESLQDELERMENEKTELRVELRGAEKSTE 198 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/63 (25%), Positives = 32/63 (50%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSV 505 +E NKLQ Q+ +L Q+R +L +D + + ++ +Q K+D+ +E + Sbjct: 932 EELNNKLQKQEEELGRQIRVLNHQLMMVKDEHAGMASSLEQAQQIAQQSKQDISRVEDKL 991 Query: 506 QKS 514 + S Sbjct: 992 EAS 994 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/66 (24%), Positives = 33/66 (50%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 LA T+E+ + + L N + + L + QL ++++ + LK+D+EDL Sbjct: 145 LARTEEKLDSEHSAVGSLVNHTKQVEQTLMGNQQ---QLLSRREQIHVRLERLKEDLEDL 201 Query: 494 ELSVQK 511 + S ++ Sbjct: 202 QDSYEQ 207 >SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) Length = 166 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 344 AC*RAPGSRQGCPGFLRGWRAGRSSPQAAWR*GPRPPCG 228 AC +A G++ P F+ G ++G SSP +R P PP G Sbjct: 115 ACEKAMGNQ---PHFIEGQKSGPSSPVGWFRRTPPPPPG 150 >SB_19380| Best HMM Match : DUF827 (HMM E-Value=0.06) Length = 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/64 (17%), Positives = 36/64 (56%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKD 481 N ++ ET+ N+L+ +L++++++ + + NQL + ++ ++++ ++ Sbjct: 50 NDKAIEETKREINRLENLSVNLQDKVKNYEHLNETGTERTNQLQEQLQETQEQIGDTREA 109 Query: 482 VEDL 493 +ED+ Sbjct: 110 LEDI 113 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 8/74 (10%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQL-------FQAKKKL-EQEVSGL 472 A +ER N+++ K E Q+ ++ + QE+D NQL + A K+ + ++ L Sbjct: 598 AVLRERENEMKGLKEMYEEQIAQLKESVLQEKDRYNQLETDCTKKYSALKRTGDMKIDEL 657 Query: 473 KKDVEDLELSVQKS 514 K+++ L ++ S Sbjct: 658 KEEISALSAKLKTS 671 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 314 LAETQ--ERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 L+ET +R+ LQ QK EN + ++ + E +L + +++ VSGL DVE Sbjct: 739 LSETYAGDRSRLLQDQKEATENHEQAMTEQRQRLESQIEKLKEENGQMKSTVSGLASDVE 798 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 11/74 (14%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLT--QEE--DARNQLFQAKKKLEQ-------EVS 466 E + KL+ +LE L +D L Q E + +N+L AK++ E+ E+S Sbjct: 1760 EFSAKQRKLERLGVELEEALELEKDALCRCQSELANCKNELEIAKQQHEEVIKGKMREIS 1819 Query: 467 GLKKDVEDLELSVQ 508 LKK+ EDL +Q Sbjct: 1820 QLKKECEDLNAKIQ 1833 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +2 Query: 341 KLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 KLQ +K + ENQL + Q L A+ L + ++ + L K+ +E Sbjct: 1989 KLQKEKQEYENQLNNLQGELFSLRSAKRDLEGKLEDIQYKYDQLLKEQAPME 2040 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 29.1 bits (62), Expect = 2.3 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = +2 Query: 329 ERANKLQAQKADLENQLRDTQDRLTQ---EE--DARNQLFQAKKKLEQEVSGLKKDVEDL 493 E A L ++ A LE +L+DT Q EE D NQL K++ EQE+ LK+++ Sbjct: 953 EFAEHLASKVASLELKLQDTVAEEVQAYREEIKDFENQLEIEKQRAEQELGVLKEELTKA 1012 Query: 494 E 496 E Sbjct: 1013 E 1013 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 29.1 bits (62), Expect = 2.3 Identities = 15/70 (21%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRDTQD-RLTQEEDARNQLFQAKKKLEQEVSGLKK 478 NQ ++ E ++ K+ + + ++ + R+T+ + Q+ KKLE E G ++ Sbjct: 2076 NQTAIDENSQQREKISNLRDVMTKRVSEEWSIRITENCTLKKQVADLIKKLESERKGYEQ 2135 Query: 479 DVEDLELSVQ 508 ++DL+ ++ Sbjct: 2136 QIKDLKAELE 2145 >SB_26444| Best HMM Match : CAP_GLY (HMM E-Value=1.2e-23) Length = 1024 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKK--KLEQEVSGLKKDVEDL 493 E + + L+ + LE + + D +NQL AKK + QE LK+ VE+L Sbjct: 297 EDKHKMKDLEKARMQLEQMIEYKSKWQEAQRDLQNQLTAAKKLEGMMQENEQLKERVEEL 356 Query: 494 ELSVQ 508 L ++ Sbjct: 357 TLDLE 361 Score = 27.9 bits (59), Expect = 5.3 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 Q + E A +L++ A+L+ Q+ D E+ L +LE+EV L+ V Sbjct: 427 QADKDQLMEEAEQLESTLAELKEQV----DTALGAEEMVETLTDKNLELEEEVQTLRDTV 482 Query: 485 EDLE 496 DLE Sbjct: 483 SDLE 486 >SB_28543| Best HMM Match : DUF1337 (HMM E-Value=2.4) Length = 238 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQE 460 +E N ++AQK +LE + ++ L E + + +AK KLE E Sbjct: 178 KEGLNDMKAQKVELEKIFQGEKNALKIEYSQKEKQLKAKMKLEFE 222 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 28.7 bits (61), Expect = 3.0 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +2 Query: 311 SLAETQERANKLQAQKADLENQLRDTQDRLTQE-EDARNQLFQA-KKKLEQEVSGLKKDV 484 SL E + + L K +EN + + RLTQ D +L QA + + + L+K+ Sbjct: 416 SLNEVKTLLSTLNDGKKAMENAIHENTKRLTQALFDREKELLQAVDLAYQNKETLLRKEK 475 Query: 485 EDLELSVQK 511 E LEL +++ Sbjct: 476 EHLELILER 484 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/58 (17%), Positives = 35/58 (60%) Frame = +2 Query: 341 KLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQKS 514 +++ ++ + EN++ + ++R+ +EE+ + +K++ ++ +K E++E+ K+ Sbjct: 195 EMRREREEEENRILEEEERVKREEEEKKAKEVEEKRMGEDEEQIKLKEEEVEIKEDKT 252 >SB_39000| Best HMM Match : TolA (HMM E-Value=0.55) Length = 576 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/65 (27%), Positives = 35/65 (53%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 QGS + ER + +A+K + D + + +EED R + + +++ E E ++D+ Sbjct: 445 QGSKKKDLERTTE-EARKV-----VADLDEGIREEEDKRRGMERKRQEKELEKRKAERDI 498 Query: 485 EDLEL 499 ED E+ Sbjct: 499 EDCEM 503 >SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) Length = 1011 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/56 (28%), Positives = 33/56 (58%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKD 481 +++ Q++ N L+ ++ L+DTQ RL E+ +N+ + LE +++ L+KD Sbjct: 196 ISDLQKKENSLE----EMTELLKDTQTRLQSEKLVKNEYIIKCEILEGKLAMLEKD 247 >SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARN-QLFQAKKKLE-QEVSGLKKDVEDL 493 E +A K+ E QL+ +DR Q+E+++ +AKK++E +E + + E L Sbjct: 369 EDMNKAGNKDKAKSVYEKQLQALKDRRKQDEESKKIAALRAKKEMEVKEEADQEWSDEQL 428 Query: 494 ELSVQ 508 +L V+ Sbjct: 429 QLLVK 433 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSV 505 QE L+ + +E +LRD+Q + ++L + LE V +KD ++L +V Sbjct: 982 QEELETLKDKTLKVERELRDSQQENIKMNIENSKLSRKVSSLESSVEIFEKDKKNLRTTV 1041 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 329 ERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQE 460 ER LQ + D++NQ + D L +ED +L L+ E Sbjct: 4 ERIRGLQEELNDVQNQYSECYDELVHQEDLMGRLRDEISSLQTE 47 >SB_50756| Best HMM Match : S-antigen (HMM E-Value=2.4e-09) Length = 712 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/57 (22%), Positives = 30/57 (52%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 ++ + + Q ++ENQL+ + + Q +D ++ + +LEQ + LK+ L+ Sbjct: 603 EKSSEEADLQACEIENQLKHAKMVIQQLKDQELEMAKQIDELEQHIETLKQQNNSLQ 659 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/63 (19%), Positives = 36/63 (57%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 + ++ +++ ++ ++ N + D + + ++ + L + KK+LE+E++ +K + LE Sbjct: 47 DIEKLKQEIEQKEREINNLRKTRNDEVKKLKERIHVLEEEKKRLEEELASVKYKLTALES 106 Query: 500 SVQ 508 V+ Sbjct: 107 EVK 109 >SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) Length = 493 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 AE +E+ ++++A L + +++L + E + F+ + L V+ L+KD+ED Sbjct: 92 AEVKEKDDQVKA----LREKCSKLREKLAKTEQEKEDHFRTRNYLADLVNDLRKDLED 145 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/67 (20%), Positives = 34/67 (50%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 L +++ + AQ + + +L + + + E ++ + +E++ GLK + EDL Sbjct: 494 LLSMKQKVMEFDAQMTEQDKELHEALNSRKELETTVEEMNVKIRSIERDNRGLKVEKEDL 553 Query: 494 ELSVQKS 514 E +Q++ Sbjct: 554 ERVLQEA 560 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.9 bits (59), Expect = 5.3 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLT--QEEDARNQLFQAKKKLEQEVSGLKK 478 Q L E + R+ + ++ + E + R+ Q +L +EE R Q + KK+ E+E K Sbjct: 168 QKRLEEERIRSQNEERKRREREQKEREKQQKLDMEKEERRRRQQEEEKKRREEEEKRKKV 227 Query: 479 DVEDLE 496 + E E Sbjct: 228 EKEKQE 233 >SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQE 460 E R NK + ++ Q R+ +DR +EE+ ++Q + +K+ E+E Sbjct: 25 EAVNRLNKTKEERFPDLRQEREQRDREEREEEKKSQREKRQKEKEEE 71 >SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1503 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLE 454 QG++ E ++LQA+K ++++LR +L +E+ A + + KL+ Sbjct: 182 QGNIDEMNAEIDRLQAEKRQVDSELR----KLQEEQQAMHHQSSTQAKLD 227 >SB_23665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVED 490 AE +E+ ++++A L + +++L + E + F+ + L V+ L+KD+ED Sbjct: 92 AEVKEKDDQVKA----LREKCSKLREKLAKTEQEKEDHFRTRNYLADLVNDLRKDLED 145 >SB_21610| Best HMM Match : HSF_DNA-bind (HMM E-Value=0.32) Length = 425 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/57 (26%), Positives = 31/57 (54%) Frame = +2 Query: 323 TQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 + + KL+ + A LE + QD++ + E+ + L + ++ +E+ LKK+ E L Sbjct: 265 SDQEKEKLRERIALLEEAISHRQDKIQRLEENGSTLDRRLAEIMEELENLKKENETL 321 >SB_20144| Best HMM Match : E-MAP-115 (HMM E-Value=0.41) Length = 416 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/63 (23%), Positives = 30/63 (47%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 E +E+ +L LE L DT++ +E + +L + + + +KD ED E Sbjct: 200 EAKEKQEELALDMKILEKLLDDTRNEAMEESQRKKELREENLRFMKYCEMNRKDEEDRER 259 Query: 500 SVQ 508 +++ Sbjct: 260 ALE 262 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 27.5 bits (58), Expect = 6.9 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 9/63 (14%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRD--TQDRLT-------QEEDARNQLFQAKKKLE 454 + G AET+ A+KL++ +DLE LR+ + ++T + E++ + +FQ K+ E Sbjct: 80 SHGHKAETRVPADKLRSLASDLEESLREDKAEKKVTMHNRKHARPEESDDDVFQEKRVKE 139 Query: 455 QEV 463 V Sbjct: 140 HRV 142 >SB_44354| Best HMM Match : APC_15aa (HMM E-Value=0.88) Length = 292 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +2 Query: 347 QAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 Q DL+ Q+ R +E+ RNQL + K++ G + +D++ Sbjct: 237 QPMLLDLDAQVHKFMGRNMREKSQRNQLLKKLKRIRNRYKGNNRKWQDVD 286 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +2 Query: 329 ERANKLQAQKADLENQLRDTQDRLTQEEDARNQ-LFQAKKKLEQEVSGLKKDVEDLELSV 505 E + ++ Q L +L + +D L Q +DA Q + + E+S LKK++ +L+ V Sbjct: 345 EILSNIKIQVPSLRKELLE-KDELIQRKDAELQHRMRIIDDKDAEISKLKKEIHELKCVV 403 Query: 506 QKS 514 Q++ Sbjct: 404 QQT 406 >SB_27059| Best HMM Match : APC_15aa (HMM E-Value=0.88) Length = 292 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +2 Query: 347 QAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 Q DL+ Q+ R +E+ RNQL + K++ G + +D++ Sbjct: 237 QPMLLDLDAQVHKFMGRNMREKSQRNQLLKKLKRIRNRYKGNNRKWQDVD 286 >SB_24117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1276 Score = 27.5 bits (58), Expect = 6.9 Identities = 20/68 (29%), Positives = 27/68 (39%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 Q + +TQ+ A L Q D Q + LTQ +DA Q Q L Q + Sbjct: 123 QDATTQTQQDAAAL-TQTQDATTQTQQDAAALTQTQDATTQTQQDAAALTQTQDATAQTQ 181 Query: 485 EDLELSVQ 508 +DL Q Sbjct: 182 QDLAAQTQ 189 >SB_19173| Best HMM Match : Ribosomal_L34 (HMM E-Value=5.2) Length = 63 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +2 Query: 347 QAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 Q DL+ Q+ R +E+ RNQL + K++ G + +D++ Sbjct: 8 QPMLLDLDAQVHKFMGRNMREKSQRNQLLKKLKRIRNRYKGNNRKWQDVD 57 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +2 Query: 335 ANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQK 511 A K++ QKA LEN L T ++ E A + L +++ +K ++ + L + K Sbjct: 198 AKKVKKQKATLENLLEGTVVQIPLVEKAAADIRHMHDMLHGKLATVKSEIRETSLRLIK 256 >SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/67 (23%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRDT--QDRLTQEEDARNQLFQAKKKLEQEVSGLK 475 N+ +L Q + L + + E + ++ Q R EE+A + + + +QEV L Sbjct: 156 NEAALEREQAVGDALAIARKNFERRRKEVIAQTRQQCEEEAATEASRVARLHQQEVGALD 215 Query: 476 KDVEDLE 496 + ++DL+ Sbjct: 216 QRIDDLK 222 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/65 (27%), Positives = 33/65 (50%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 E Q+RA + + + QLR ++ Q E Q Q K++ +E+S K++ + E Sbjct: 1111 EEQQRAWLEKKFQREENQQLRQQKEEERQTEWLEQQKLQRKQESTREISRKKEEKAEDEQ 1170 Query: 500 SVQKS 514 S +K+ Sbjct: 1171 SEKKA 1175 >SB_54674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/61 (24%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = +2 Query: 311 SLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAK---KKLEQEVSGLKKD 481 ++ + R +LQ++ A LE ++ +D+L + + + L AK + L+Q++ L +D Sbjct: 988 AVRHSNSRVAELQSKMASLEIVIQKLRDKLAAKSGSSDALAAAKAREENLKQQIERLNED 1047 Query: 482 V 484 + Sbjct: 1048 L 1048 >SB_45286| Best HMM Match : GRIP (HMM E-Value=3.6e-08) Length = 800 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +2 Query: 344 LQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 L+ +K DLE+ LRD R + D L + +KLE++ S ++E L+ Sbjct: 494 LRREKNDLEDDLRDCTLREAKTRDQCETLKEEIRKLERDRSRETANLEYLK 544 >SB_28230| Best HMM Match : Hormone_3 (HMM E-Value=6.3) Length = 109 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 359 ADLENQLRDTQDRLTQ--EEDARNQLFQAKKKLEQEVSGLKKDVEDLELSVQK 511 A ++ +L++ DRL ++ RN+ +Q + +L+QE+ L+ EL K Sbjct: 36 AHVDKRLKEEMDRLIHYLDQSTRNRGYQCELRLQQELKQLRMHALLYELENNK 88 >SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) Length = 503 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/56 (30%), Positives = 35/56 (62%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDL 493 Q N++ +++A+ + Q+R+ Q++L E+ + QL +K + + SGLK+ ED+ Sbjct: 351 QHDLNQVSSKEAESQ-QVRNLQNQL---EETKRQLENREKTVLELESGLKEKKEDV 402 >SB_17814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 332 RANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 R ++ + ++ L QLR+ + L +E R A+KK E ++ L+ +E Sbjct: 27 RDDQNEEKRKALLKQLRELESELDEERKLRASAVNARKKQELDLRDLEDQLE 78 >SB_6447| Best HMM Match : DUF164 (HMM E-Value=0.48) Length = 598 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/62 (25%), Positives = 34/62 (54%) Frame = +2 Query: 302 NQGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKD 481 N+ + ET E+ +++ ++ L + Q +L+ D L +A+++ +E+ LKKD Sbjct: 287 NEYNNKETGEKVSQVNQLESALSQRKNSVQRQLS---DLSESLKKAREETNKEMEQLKKD 343 Query: 482 VE 487 +E Sbjct: 344 LE 345 >SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) Length = 2024 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/66 (27%), Positives = 36/66 (54%) Frame = +2 Query: 317 AETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLE 496 +ET K+ A + ++E + TQ ++ E R+ + KLE E+ LKK+ +L+ Sbjct: 985 SETTGYQQKIAALEREVEYKTSITQGYTSEIERLRSD----RVKLESEMGTLKKEYTNLK 1040 Query: 497 LSVQKS 514 +S +++ Sbjct: 1041 VSSERN 1046 >SB_2494| Best HMM Match : M (HMM E-Value=0.0056) Length = 737 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 344 LQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVS 466 L+A+K + + + QD++ E +++ +AK L+QEV+ Sbjct: 651 LKAEKEETDKRFTAYQDKIRALEKEVSEIREAKNSLDQEVN 691 >SB_58977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 27.1 bits (57), Expect = 9.2 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 9/64 (14%) Frame = +2 Query: 335 ANKLQAQKADLENQLRDTQD-------RLTQEEDARNQLFQAKKKLEQEVSGLKKD--VE 487 A ++ Q+ L LRD QD + QE++ R + Q KK+ E+E KK +E Sbjct: 23 AARVDRQERSLAQTLRDEQDEDYRRSLQADQEKERRRREEQEKKQKEEEAERRKKQAILE 82 Query: 488 DLEL 499 LE+ Sbjct: 83 KLEV 86 >SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 335 ANKLQAQKADLENQL-RDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 A +LQ EN+L R ++++ E+D + + KK+E+ LKK ++L L Sbjct: 531 AKELQEFYVRHENKLKRVLEEKIIVEDDLESLRQEHAKKIEEAYDDLKKTQKELRL 586 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 27.1 bits (57), Expect = 9.2 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 7/69 (10%) Frame = +2 Query: 326 QERANKLQAQKADLENQLRDTQDRLTQEE-------DARNQLFQAKKKLEQEVSGLKKDV 484 +E K Q K + E +LR + L E + NQL Q K LE + KKD+ Sbjct: 1226 KEAGAKRQKLKEEYEGKLRVIYEELVSERSKNKELMNQNNQLSQKVKLLEGVTTKQKKDI 1285 Query: 485 EDLELSVQK 511 E ++ +K Sbjct: 1286 ERVKQMEEK 1294 >SB_41836| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.5e-07) Length = 1128 Score = 27.1 bits (57), Expect = 9.2 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 7/68 (10%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKL-------EQEV 463 + LA QE N L + D N+L + L E +L + L EQE+ Sbjct: 240 RSELATFQENKNMLLSTLEDTRNELDGVKGELESLEQTLRELKEKVHALEEENGEKEQEI 299 Query: 464 SGLKKDVE 487 S LK D+E Sbjct: 300 SKLKDDLE 307 >SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) Length = 961 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Frame = +2 Query: 362 DLENQLRDTQ---DRLTQEEDARNQLFQA--KKKLEQEVSGLKKDVEDLELSVQK 511 DL + L + + D + +E+D FQ K K +Q V LKK ED++L +++ Sbjct: 141 DLHSMLTEQKSACDAMFEEKDKLINDFQQELKAKDDQYVKDLKKAAEDIDLMIER 195 >SB_35206| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.012) Length = 1148 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/64 (23%), Positives = 30/64 (46%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVEDLEL 499 E L+ + D+E + D QD L E +L Q + + ++G+K++ + L Sbjct: 692 ELDSECEDLRGRLMDVEGERDDLQDSLETAEGKTIKLTQELDEKMKLIAGIKEEKQGLAA 751 Query: 500 SVQK 511 V++ Sbjct: 752 EVKQ 755 >SB_21673| Best HMM Match : Troponin (HMM E-Value=0.34) Length = 337 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 7/76 (9%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLEN-------QLRDTQDRLTQEEDARNQLFQAKKKLEQEV 463 Q SL + +E+ K A L+N Q+ +DRL++EE+ ++ K +E Sbjct: 88 QESLHDLEEKYRKNMVSIAQLDNEKQALLYQVDCLKDRLSEEEEISCEVKVELKDKTREA 147 Query: 464 SGLKKDVEDLELSVQK 511 ++ ++D E +Q+ Sbjct: 148 EKYQRQIKDNESEIQR 163 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 27.1 bits (57), Expect = 9.2 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +2 Query: 314 LAETQERANKLQAQKADLENQLRDTQDRLTQ-EEDARNQLFQAKKKLEQEVSGLKKDVED 490 L+E +L+A+ ++QLR T++RL E+ AR Q KK++ Q + D Sbjct: 1049 LSERAVEIAELKAKYDQSQDQLRQTKNRLAHYEKVARQQQEDLKKRIAQ--------LTD 1100 Query: 491 LELSVQK 511 LE+ +K Sbjct: 1101 LEVEAEK 1107 >SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06) Length = 1977 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 329 ERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQ 457 E+ KL+ Q +LRD +L++E + R + + KKK ++ Sbjct: 204 EQLEKLKEQTRPESEELRDRARQLSRETNKRRKNLEEKKKQKE 246 >SB_48386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Frame = +2 Query: 305 QGSLAETQERANKLQAQKADLENQLRDTQDRLTQEE---DARNQLFQAK-KKLEQEVSGL 472 Q + E ++ + QA+ DL+ + T D L EE DA+ + +A+ L+ + Sbjct: 589 QEKIRELEKELEESQAEVDDLQCRCNTTNDLLHIEEEKWDAKERGKEAEILDLQANLEDA 648 Query: 473 KKDVEDLELSVQK 511 K ++DLE+ +++ Sbjct: 649 KNIIKDLEMELEE 661 >SB_34623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 553 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 377 LRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDV 484 L + D+ ++ED N Q KKLE VS + +V Sbjct: 285 LESSNDQKKKQEDTLNHRIQEIKKLENTVSTISAEV 320 >SB_30634| Best HMM Match : Apolipoprotein (HMM E-Value=0.16) Length = 558 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = +2 Query: 344 LQAQKADLENQLRDTQDRLTQEEDARNQLFQAKKKLEQEVSGLKKDVE 487 LQA+ +L N+L+ +++ +D ++ K +L E+ G ++ E Sbjct: 141 LQAELDNLNNELKAKDNKIESLQDELERMENEKTELRVELRGAERSTE 188 >SB_21264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +2 Query: 320 ETQERANKLQAQKADLENQLRDTQDRLTQEEDARNQLFQA-KKKLEQEVSGLKKDVEDLE 496 E ++ +K + K D E D +D+ EE + ++ Q K++++QE KKD ED++ Sbjct: 7 EDKDEEDKEEMDKMDKEEM--DKEDKEDMEEMDKEEMDQQDKEEMDQEEMD-KKDKEDMD 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,592,031 Number of Sequences: 59808 Number of extensions: 174680 Number of successful extensions: 1348 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 1040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -