BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30323 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 24 1.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 7.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 7.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.5 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 10.0 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.8 bits (49), Expect = 1.1 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 Query: 143 VLRDGVILCKLANKLAPGSVKKIQERGTNFQLMENIQRFQAAIKKYGVPEE 295 + R+ V+L L L SV IQ+ GT F ++RF Y P+E Sbjct: 1 MFREFVLLASLLY-LGNESVHGIQKWGTQFGQAPLLERFFWRTLDYAYPDE 50 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 217 ERNQLPAHGE 246 E NQLP HG+ Sbjct: 49 ENNQLPTHGK 58 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 446 FTEEQLRAHNAELNLQMGFNK 508 FT+++ + ELNLQ FN+ Sbjct: 17 FTKQKKVKEDTELNLQTIFNE 37 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 149 RDGVILCKLANKLAPGSVKKIQ 214 R+G LC+ +N + G K +Q Sbjct: 780 REGFYLCQASNGIGSGIGKVVQ 801 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 149 RDGVILCKLANKLAPGSVKKIQ 214 R+G LC+ +N + G K +Q Sbjct: 776 REGFYLCQASNGIGSGIGKVVQ 797 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.6 bits (41), Expect = 10.0 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 401 GPQLGPKMADKNERTFTEE 457 GP+ GPK+ +K + +E Sbjct: 203 GPEKGPKVPEKKKEDEIDE 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,697 Number of Sequences: 438 Number of extensions: 3781 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -