BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30320 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1296 + 32437089-32437386,32437422-32437429 28 5.1 01_07_0039 - 40667598-40669880 28 5.1 03_02_1012 + 13207907-13207990,13209196-13209280,13209402-132101... 27 8.9 >04_04_1296 + 32437089-32437386,32437422-32437429 Length = 101 Score = 27.9 bits (59), Expect = 5.1 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -2 Query: 323 RSAIKMDPY*TIKTPEKFTRHSTTWHSA*HVSIHTGP 213 RSA+ DP +KT HSTTW A S+ GP Sbjct: 4 RSAVYFDP--KVKTHTSLAHHSTTWVVA---SVRLGP 35 >01_07_0039 - 40667598-40669880 Length = 760 Score = 27.9 bits (59), Expect = 5.1 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 Query: 261 LHNLAQCVTR*HTYRTDRDITTCFEL*IRLKPETLQMHRTARS 133 +HNL R ++R D+ T FEL PE LQ T+ S Sbjct: 458 IHNLLMFSHRIPSFRFTCDVGTVFELEHSAVPENLQYENTSAS 500 >03_02_1012 + 13207907-13207990,13209196-13209280,13209402-13210186, 13210262-13210462,13210580-13210690,13211105-13211487, 13211594-13211702,13211786-13211866,13212088-13212156, 13212379-13212467,13212619-13212780,13212859-13212916, 13213143-13213373,13213516-13213662,13213779-13214333, 13214562-13214819,13215096-13215203,13215760-13215854, 13215946-13216102,13216466-13216666,13217542-13217670, 13218292-13218567 Length = 1457 Score = 27.1 bits (57), Expect = 8.9 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 456 RSLKFSVMTILKLMRSRK-PTNIFLKKTIIFDSLVKENTYKLTSNQE 319 R +KF V LKLMRS T + +IF V + Y+L +E Sbjct: 384 REVKFKVSRSLKLMRSAAIRTRRLARDMLIFWKRVDKEQYELRKREE 430 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,328,986 Number of Sequences: 37544 Number of extensions: 201878 Number of successful extensions: 428 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -