BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30320 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. 25 2.0 AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. 25 2.0 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 4.6 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 4.6 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 4.6 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 8.1 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 8.1 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 8.1 >AY344840-1|AAR05811.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 136 VGYSDATTTLTSLPEIRNLWH 74 +G S +TTT S+P+ WH Sbjct: 133 IGSSGSTTTKESVPDTITAWH 153 >AY344839-1|AAR05810.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 136 VGYSDATTTLTSLPEIRNLWH 74 +G S +TTT S+P+ WH Sbjct: 133 IGSSGSTTTKESVPDTITAWH 153 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 193 TGRYIAIGPVCMLTCHALCQVVECRVNFSGVL 288 TGRY P C C+ V+C+ +G L Sbjct: 667 TGRYCEKCPTCAGRCNEFKHCVQCQQYKTGPL 698 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.4 bits (48), Expect = 4.6 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 130 YSDATTTLTSLPEIRNLW 77 Y+ T T+T+LP++ + W Sbjct: 49 YNVTTKTMTALPDLEDYW 66 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 4.6 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 130 YSDATTTLTSLPEIRNLW 77 Y+ T T+T+LP++ + W Sbjct: 49 YNVTTKTMTALPDLEDYW 66 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 22.6 bits (46), Expect = 8.1 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +3 Query: 291 SLIRIHFNSTPDSKSICMYFL*LDYRI*SFFLKRYLSVFLTSLTSISSSPKTLDSV 458 S +R S P+S S+ F DYR + L R F TS+ + ++ +++ Sbjct: 260 SRVRNELPSAPNSLSVRYNFRLTDYRKLNSILSRADWSFFYQCTSVDEAVQSFNAL 315 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 136 VGYSDATTTLTSLPEIRNLWH 74 +G S + TT S+P+ WH Sbjct: 133 IGSSGSATTKESVPDTITAWH 153 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 216 TDRDITTCFEL*IRLKPETLQMHRTARS 133 T I CF +PET ++H ARS Sbjct: 190 TSSVIDVCFATPSIARPETWEVHEFARS 217 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 473,968 Number of Sequences: 2352 Number of extensions: 8029 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -