Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30320
         (516 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL032630-9|CAA21565.1|  369|Caenorhabditis elegans Hypothetical ...    28   3.4  

>AL032630-9|CAA21565.1|  369|Caenorhabditis elegans Hypothetical
           protein Y62H9A.9 protein.
          Length = 369

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = -1

Query: 420 LMRSRKPTNIFLKKTIIFDSLVKENTY-KLTSNQEC 316
           L+R+ +PT+I+ KK ++F    +  TY  L  N  C
Sbjct: 149 LVRTNRPTDIYKKKYLLFPVSFRAETYCTLVVNPHC 184


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,486,262
Number of Sequences: 27780
Number of extensions: 202719
Number of successful extensions: 486
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 475
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 486
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 996506972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)