BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30318 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC736.09c |||TRAX |Schizosaccharomyces pombe|chr 3|||Manual 26 2.9 SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|... 26 3.8 SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein T... 25 5.1 >SPCC736.09c |||TRAX |Schizosaccharomyces pombe|chr 3|||Manual Length = 231 Score = 26.2 bits (55), Expect = 2.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 481 KLSYLLHTCSLAEWFAPPSDIYKVFYFQHLIHK 383 ++ +LLH S ++ F P D + F+ IHK Sbjct: 35 RMIFLLHQTSSSDGFPLPKDFDRTSIFEKKIHK 67 >SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 784 Score = 25.8 bits (54), Expect = 3.8 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +2 Query: 101 DEHTAYLMVNGYLRSSTSALPLVKLSRSLPIEIYALPIY 217 D++ ++N Y+ ++ S L L++ S+SL +Y+L Y Sbjct: 395 DDNFTLNIMNAYVYANESLLQLLQSSQSLYAHLYSLKHY 433 >SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein Trt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 988 Score = 25.4 bits (53), Expect = 5.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 397 VGSRKLCIYPMVEQTIRPTSMYAINSLV*HY 489 V R L +YP++EQT + +++ + HY Sbjct: 291 VPKRLLKVYPLIEQTAKRLHRISLSKVYNHY 321 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,880,059 Number of Sequences: 5004 Number of extensions: 33171 Number of successful extensions: 72 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -