BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30318 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1353 + 35866130-35866297,35866438-35868762 33 0.14 07_01_0156 + 1106058-1107596 28 3.9 06_03_0259 - 18851809-18852561,18852659-18852895 28 5.1 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 27 6.8 >02_05_1353 + 35866130-35866297,35866438-35868762 Length = 830 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +1 Query: 43 SAFNIYSVELDLFVVTIVGRRAHGLPDGKWLPSFIDISTAISKA 174 +AF L +F + +VG A+G PDG+ PSF D+S +S A Sbjct: 193 AAFANDMASLSVFSIMVVGTTAYG-PDGQPTPSFPDMSIVMSMA 235 >07_01_0156 + 1106058-1107596 Length = 512 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 266 TKVYIIIYYYALIRDDCRLVTRKFQWAASG 177 TK + +Y+ I CR R+F+W A G Sbjct: 110 TKSLVSSLFYSNIDGSCRSAVRRFEWFADG 139 >06_03_0259 - 18851809-18852561,18852659-18852895 Length = 329 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 182 SGLALLMAVLMSMNEGNHLPSGRPCA 105 + L+LL+AVL S EG+H P P A Sbjct: 10 ASLSLLLAVLASTGEGSHQPVVMPVA 35 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 266 TKVYIIIYYYALIRDDCRLVT 204 TK +II Y+YA +R +CR T Sbjct: 838 TKKFIINYFYAFLRRNCRAGT 858 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,644,154 Number of Sequences: 37544 Number of extensions: 196298 Number of successful extensions: 412 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -