BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30318 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 2.5 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 5.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 5.7 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -2 Query: 254 IIIYYYALIRDDCRLVTRKFQWAASGLALLMAVL 153 ++ ++Y DD +LV F W L +++A++ Sbjct: 378 LVPFFYVQEDDDVKLVLLNFGWQMICLIVVIALV 411 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 404 VENFVYIRWWSKP 442 V N RWWS+P Sbjct: 37 VNNIKRKRWWSRP 49 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 432 HHRIYTKFSTS 400 HHR+Y FS+S Sbjct: 68 HHRLYPAFSSS 78 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,270 Number of Sequences: 438 Number of extensions: 2264 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -