SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30318
         (516 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein pr...    23   2.5  
L10433-1|AAA27732.1|  149|Apis mellifera transposase protein.          21   5.7  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   5.7  

>DQ011228-1|AAY63897.1|  486|Apis mellifera Amt-2-like protein
           protein.
          Length = 486

 Score = 22.6 bits (46), Expect = 2.5
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = -2

Query: 254 IIIYYYALIRDDCRLVTRKFQWAASGLALLMAVL 153
           ++ ++Y    DD +LV   F W    L +++A++
Sbjct: 378 LVPFFYVQEDDDVKLVLLNFGWQMICLIVVIALV 411


>L10433-1|AAA27732.1|  149|Apis mellifera transposase protein.
          Length = 149

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = +2

Query: 404 VENFVYIRWWSKP 442
           V N    RWWS+P
Sbjct: 37  VNNIKRKRWWSRP 49


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 432 HHRIYTKFSTS 400
           HHR+Y  FS+S
Sbjct: 68  HHRLYPAFSSS 78


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,270
Number of Sequences: 438
Number of extensions: 2264
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14354847
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -