BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30311 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 4.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 4.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 4.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.5 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 7.5 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 381 HDGQGNNAGSLVSITKVFA 325 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 381 HDGQGNNAGSLVSITKVFA 325 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 381 HDGQGNNAGSLVSITKVFA 325 H G G N G + ITK+ A Sbjct: 148 HTGVGRNVGYKIPITKLTA 166 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 7.5 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +1 Query: 40 LSLTVALAAETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSRDNSGRYIPDNS 213 ++LT+A +T K P N + ++Y + R + NS + + DNS Sbjct: 295 MNLTLAKMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNS 352 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 7.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 324 QQIPW*CLQGIQHCS 368 QQI W L+ IQ CS Sbjct: 557 QQIAWMALKMIQACS 571 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.136 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,728 Number of Sequences: 438 Number of extensions: 2222 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -