BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30309 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 28 0.16 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 26 0.66 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 4.6 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 8.1 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 8.1 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 28.3 bits (60), Expect = 0.16 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -3 Query: 469 SLIVTTSTLSYRVLIPSKLLQGLTLAYKSNSFLR 368 S+ TT++ + L+PS + GL++ ++SFLR Sbjct: 92 SITTTTTSTCHSHLLPSLAITGLSIGSSNSSFLR 125 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 26.2 bits (55), Expect = 0.66 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 469 SLIVTTSTLSYRVLIPSKLLQGLTLAYKSNSFLR 368 S+ TT++ + L+PS + GL++ ++ FLR Sbjct: 92 SITTTTTSTCHSHLLPSLAITGLSIGSSNSRFLR 125 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 4.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 271 GIPNLPSGPLTAVTSTSSHSI 209 G P +P+GP + T+ S +SI Sbjct: 251 GCPTIPAGPSKSATNHSINSI 271 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 338 DWSHQGTLQANFIG 297 DWS GT A FIG Sbjct: 2786 DWSQPGTWNALFIG 2799 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 14 LPLVFAICENS*NGC 58 +P++FAIC N N C Sbjct: 535 MPVIFAICFNILNWC 549 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,528 Number of Sequences: 2352 Number of extensions: 10041 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -