BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30308 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 26 0.23 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 24 0.70 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 1.2 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 2.1 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 2.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 2.8 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 4.9 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 4.9 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 25.8 bits (54), Expect = 0.23 Identities = 18/66 (27%), Positives = 34/66 (51%) Frame = +3 Query: 231 KDGSESVLQQLNAFAKSLQGALGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATA 410 KD E++LQ++ + LGD + K + Q+ + +ER +E + +P V + A Sbjct: 16 KDVQETILQEM-------RDVLGDIHAKPTYSDLQNLKYLERCIKESLRLYPSVHLISRA 68 Query: 411 LREKLQ 428 L E ++ Sbjct: 69 LGEDVR 74 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 24.2 bits (50), Expect = 0.70 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 7/39 (17%) Frame = +3 Query: 105 RRDAPDFFKDIEH-----HTKEFHKT--LEQQFNSLTKS 200 RR AP F+DI+H + +E +T L + F SL KS Sbjct: 84 RRKAPQSFEDIQHQRVMANVRERQRTQSLNEAFASLRKS 122 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 23.4 bits (48), Expect = 1.2 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 217 KSCASFDLVSELNCCSKVLWNS-LVWCSMSLKKSGASRRTIAPWARA 80 KS A+FD V+ + +LW S L + K +R I W A Sbjct: 418 KSLAAFDFVARNSDTPIILWTSHLTQADVIEKYLSKARYVIQTWVPA 464 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 208 ASFDLVSELNCCSKVLWNSLV 146 A D SE++C S+ +W+ L+ Sbjct: 102 ALLDTGSEVSCISEEVWSKLI 122 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 65 SLRLHRSGPRSDGATRRS-RLLQGHR 139 ++RL R+GPR++ A R++ HR Sbjct: 179 NIRLKRAGPRTESAVYEPVRIMGVHR 204 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 372 GAPRPCARCSASTVPKPPWPCRSRLRALPG 283 G P+P + CS + P C L L G Sbjct: 1271 GGPQPYSACSENAFAAYPGDCTRYLHCLWG 1300 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.4 bits (43), Expect = 4.9 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 276 KSLQGALGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 425 + + LGD K Q + +ER +E+ + +P V + L E L Sbjct: 340 EEMNEVLGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDL 389 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 4.9 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 276 KSLQGALGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 425 + + LGD K Q + +ER +E+ + +P V + L E L Sbjct: 340 EEMNEVLGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDL 389 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,927 Number of Sequences: 336 Number of extensions: 1507 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -