BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30304 (326 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77659-4|CAB01163.1| 507|Caenorhabditis elegans Hypothetical pr... 46 6e-06 Z81044-2|CAB02813.1| 337|Caenorhabditis elegans Hypothetical pr... 41 2e-04 >Z77659-4|CAB01163.1| 507|Caenorhabditis elegans Hypothetical protein F23B12.5 protein. Length = 507 Score = 46.0 bits (104), Expect = 6e-06 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = +1 Query: 223 FVDLPLSGMRETIAKRLTVAKQSIPHYQLS 312 + D+PLS MR+TIAKRLT +K +IPHY L+ Sbjct: 275 YTDIPLSNMRKTIAKRLTESKSTIPHYYLT 304 >Z81044-2|CAB02813.1| 337|Caenorhabditis elegans Hypothetical protein C30H6.7 protein. Length = 337 Score = 41.1 bits (92), Expect = 2e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +1 Query: 229 DLPLSGMRETIAKRLTVAKQSIPHYQLSVTV 321 D+PLS +R TIAKRLT +KQ IPH V V Sbjct: 102 DIPLSNIRATIAKRLTASKQQIPHEYQGVDV 132 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,740,129 Number of Sequences: 27780 Number of extensions: 37512 Number of successful extensions: 133 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 398409266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -