BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30302 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0097 - 1171949-1172047,1172520-1172591,1172791-1172949,117... 29 1.7 03_01_0068 - 546475-546615,546709-546819,547449-547482,547582-54... 27 8.9 02_01_0016 + 110796-110979,111252-111768,111847-112213 27 8.9 >10_01_0097 - 1171949-1172047,1172520-1172591,1172791-1172949, 1172998-1173381,1173478-1175253,1175329-1175452, 1176859-1177027,1177131-1177226,1177339-1177527, 1177965-1179303 Length = 1468 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/77 (23%), Positives = 29/77 (37%) Frame = -2 Query: 338 HDYQNKQRQ*QPNDSRSHRHYPSFHSPIALVHCRASVLPLKITTHQVLGRILHFLHGFLL 159 H+ + + Q P S Y P+ CRA + + + + R H + Sbjct: 444 HNPEEAELQCVPKSFESAEEYIRVFEPLLFEECRAQLYSSYEESLESVSRDAHVMVRVKT 503 Query: 158 RVHRNRVWYECVLLGHH 108 R R WY+ V+L H Sbjct: 504 VERRERGWYDVVVLPMH 520 >03_01_0068 - 546475-546615,546709-546819,547449-547482,547582-547673, 547904-548062,548178-548251,548477-548551,548820-548903, 548981-549110 Length = 299 Score = 27.1 bits (57), Expect = 8.9 Identities = 17/61 (27%), Positives = 31/61 (50%) Frame = -3 Query: 400 AIMFAVRSSISLRKRAMWISLTITRTSNANSSPMIVAVTVTTQAFIRRSHLFIVGPPYCL 221 A+ A +S+ L RA+ ++ +S++ +SP + A T +FI+ + PP L Sbjct: 4 AVSRAAFASVLLAPRAVGVAARCASSSSSAASPSVAAATYDHASFIK--EVAATDPPEHL 61 Query: 220 S 218 S Sbjct: 62 S 62 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 165 ETMKEVKDASKNLMGGDFERQYGGPTMNKCDRRM 266 E+ V++ + N GG R G P MN+C R+ Sbjct: 73 ESPVTVRECNTNWFGGFSVRMEGTPEMNRCTARV 106 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,553,179 Number of Sequences: 37544 Number of extensions: 283128 Number of successful extensions: 810 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -