BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30298 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_41818| Best HMM Match : Brix (HMM E-Value=0.015) 56 1e-08 SB_8855| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_8939| Best HMM Match : EBV-NA3 (HMM E-Value=8.2) 33 0.18 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 30 1.3 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 30 1.3 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_55144| Best HMM Match : CMAS (HMM E-Value=0.72) 29 1.7 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_29237| Best HMM Match : I-set (HMM E-Value=0) 29 2.3 SB_20226| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_6936| Best HMM Match : TP2 (HMM E-Value=1.1) 29 3.0 SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_49531| Best HMM Match : C2 (HMM E-Value=2.9e-13) 28 5.3 SB_17697| Best HMM Match : JmjC (HMM E-Value=2.4e-11) 28 5.3 SB_41955| Best HMM Match : RVT_1 (HMM E-Value=5.3e-15) 27 6.9 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 27 6.9 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_48724| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 58.4 bits (135), Expect = 3e-09 Identities = 35/118 (29%), Positives = 64/118 (54%) Frame = +3 Query: 162 EGDDVPKKIPHTLETLREKDETMLVNADTEEQEEAQKDMELDELSTYYENSYEPKVLITY 341 EG +P ++ LRE + D E+ E+ ++ DE + + +PK++IT Sbjct: 69 EGKAIPTELRKDEAELREA-----IEFDDEKHEKVGSHID-DEYA--WAGVEDPKIMITT 120 Query: 342 SDNPHSKTRIFGRELTRIIPNSLSRYRQRSSVKRIVQSAIREDVTDVIIINENQRQPN 515 S NP S+ + F +E+ + PNS R +K++V + DVTD+II++E++ +P+ Sbjct: 121 SHNPSSRLKQFAKEMRLVFPNSQRLNRGNYVMKQLVDACKANDVTDLIIVHEHRGEPD 178 >SB_41818| Best HMM Match : Brix (HMM E-Value=0.015) Length = 170 Score = 56.4 bits (130), Expect = 1e-08 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 2/104 (1%) Frame = +3 Query: 165 GDDVP-KKIPHTLETLREKDETMLVNADTEEQEEAQKDMELDELSTYYENSYEPKVLITY 341 GD+ P K++P T+E R +DETM+ D EE +D DELS Y++ PKVLIT Sbjct: 49 GDEAPPKQVPRTIENTRVQDETMVDPLD----EEVLQDESTDELSYYFKREVTPKVLITS 104 Query: 342 SDNP-HSKTRIFGRELTRIIPNSLSRYRQRSSVKRIVQSAIRED 470 SD P H ++ + I+ N +R SV R++ + D Sbjct: 105 SDRPKHGHGKMTSHKPELILNNFNTRLGH--SVARVLAALFPYD 146 >SB_8855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = +3 Query: 171 DVPKKIPHTLETLREKDETMLVNADTEEQEEAQKDMELDELSTYYENSYEPK 326 D PK++ T +T +KD+ M V A + + +QKD + L+T Y +S + K Sbjct: 243 DKPKEVLATGDTHSQKDKPMEVLATGDTRHTSQKDKPKEVLATGYTHSQKDK 294 >SB_8939| Best HMM Match : EBV-NA3 (HMM E-Value=8.2) Length = 236 Score = 32.7 bits (71), Expect = 0.18 Identities = 11/41 (26%), Positives = 27/41 (65%) Frame = +3 Query: 159 QEGDDVPKKIPHTLETLREKDETMLVNADTEEQEEAQKDME 281 +E ++ +++P +E + + + ++V +DT E+EE ++ ME Sbjct: 188 EEDEEATEEMPEVVEVIPKAKKLVVVESDTSEEEEEEESME 228 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -1 Query: 258 LVPRCQH*RASSHLFHEEFPTCEGFS*VHHLPLVSFLTCVFF--YPFHEPFCTFIFYATK 85 L+P+C S H+ H E+ TC +S H+ + TC + + H +CT Y+ Sbjct: 74 LLPQCTE--YSEHMIHHEWCTCTEYS--EHMIHHEWCTCTEYSEHMIHHEWCTCTEYSEH 129 Query: 84 VV 79 ++ Sbjct: 130 MI 131 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 228 SSHLFHEEFPTCEGFS*VHHLPLVSFLTCVFF--YPFHEPFCTFIFYATKVV 79 S H+ H E+ TC +S H+ + TC + + H +CT Y+ ++ Sbjct: 127 SEHMIHHEWCTCTEYS--EHMIHHEWCTCTEYSEHMIHHEWCTCTEYSEHMI 176 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 228 SSHLFHEEFPTCEGFS*VHHLPLVSFLTCVFF--YPFHEPFCTFIFYATKVV 79 S H+ H E+ TC +S H+ + TC + + H +CT Y+ ++ Sbjct: 172 SEHMIHHEWCTCTEYS--EHMIHHEWCTCTEYSEHMIHHEWCTCTEYSEHMI 221 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -1 Query: 228 SSHLFHEEFPTCEGFS*VHHLPLVSFLTCVFF--YPFHEPFCTFIFYATKVV 79 S H+ H E+ TC +S H+ + TC + + H +CT Y+ ++ Sbjct: 217 SEHMIHHEWCTCTEYS--EHMIHHEWCTCTEYSEHMIHHEWCTCTEYSEHMI 266 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 29.9 bits (64), Expect = 1.3 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 159 QEGDDVPKKIPHTLETLREKDETMLVNADTEEQEEAQKDMELDELSTYY--ENSYEP 323 +E + PKK L+ +E++E L A + Q+EAQK++ S+ Y +SY P Sbjct: 320 KESQEPPKKNERDLQE-QEEEELQLAMALSLSQDEAQKEVRPSPKSSLYGSPDSYSP 375 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 201 ETLREKDETMLVNADTEEQEEAQKDMELDELSTYYEN 311 ETL+EK E + EE++E +K + + Y+E+ Sbjct: 809 ETLKEKQERLKAKKKEEEEKELEKRSKTKDAKKYFES 845 >SB_55144| Best HMM Match : CMAS (HMM E-Value=0.72) Length = 529 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +3 Query: 210 REKDETMLVNADTEEQEEAQKDMELDELST 299 +EKDE LVN DT AQ+D+E+ LST Sbjct: 321 KEKDEKQLVNNDT-----AQEDVEISSLST 345 >SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +3 Query: 237 NADTEEQEEAQKDMELDELSTYYENSYE-PKVLITYSDNPHSKTRIFGRELTRIIPNSLS 413 N D ++ EE + +D S+ N++ P + S++ H+ R ELT+ ++ Sbjct: 132 NQDKKKSEEPPEYEVVDGDSSQSSNTFSGPSSISEPSESSHADKRNRSGELTQSQNDNKE 191 Query: 414 RYRQRSSVKRIVQS 455 + RQR V + V+S Sbjct: 192 KKRQRKEVGKSVES 205 >SB_29237| Best HMM Match : I-set (HMM E-Value=0) Length = 869 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +3 Query: 210 REKDE-TMLVNADTEEQEEAQKDMELDELST 299 ++KD+ T VN D E EEAQ D+ L ++T Sbjct: 723 QKKDQLTTPVNGDVENDEEAQDDLALQPINT 753 >SB_20226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 171 DVPKKIPHTLETLREKDETMLVNADTEE 254 D K PHT TLRE++ T + A+TEE Sbjct: 548 DTVNKEPHTA-TLRERNTTRQIRAETEE 574 >SB_6936| Best HMM Match : TP2 (HMM E-Value=1.1) Length = 256 Score = 28.7 bits (61), Expect = 3.0 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +3 Query: 267 QKDMELDELSTYYENSYEPKVLITYSDNPHSKTRIFGRELTRIIPNSLSRYRQRS 431 +KD +LD+ + NSY PK D P + ++ R+ +R P S SR R+R+ Sbjct: 170 RKDRQLDKKTKTLPNSYAPK-----RDKPRERKKV-ARDRSR-SPRSRSRSRERT 217 >SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/57 (31%), Positives = 24/57 (42%) Frame = +3 Query: 159 QEGDDVPKKIPHTLETLREKDETMLVNADTEEQEEAQKDMELDELSTYYENSYEPKV 329 Q D K+I L R+ + M E+ E D +LDEL Y + PKV Sbjct: 114 QMADTAAKRIGKVLNINRDNERMM------EDYERLASDRKLDELRNYRKGEKPPKV 164 >SB_49531| Best HMM Match : C2 (HMM E-Value=2.9e-13) Length = 752 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 189 PHTLETLREKDETMLVNADTEEQEEAQKDMELDELSTYYENSYEPKVLITYSDNPHS 359 P ++ ++ N DT++ E + +LS + S L++YS NP+S Sbjct: 596 PMSMSAFDKQKPGTSANDDTKQDERVRHSYHAGDLSEHAPLSRSQTSLLSYSPNPNS 652 >SB_17697| Best HMM Match : JmjC (HMM E-Value=2.4e-11) Length = 1054 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 162 EGDDVPKKIPHTL-ETLREKDETMLVNADTEEQEEAQKDMELDE 290 EG DVP K P T+ E ++EK + + E +++ K E E Sbjct: 65 EGQDVPNKEPMTVKELIKEKIRSRETSRTKSEGQDSPKPAEAQE 108 >SB_41955| Best HMM Match : RVT_1 (HMM E-Value=5.3e-15) Length = 962 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +3 Query: 282 LDELSTYYENSYEPKVLITYSDNPHSKTRIFGRELTRIIPNSLSRYRQRSSVKRIVQS 455 + +LS Y++ + L+TYS+N K ++ + + RY+ SS ++ +S Sbjct: 311 VSKLSIKYQDLRQSSTLMTYSENGEGKVQLVWYSVLMRNKRDIKRYKFNSSDQKESES 368 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/79 (18%), Positives = 36/79 (45%) Frame = +3 Query: 279 ELDELSTYYENSYEPKVLITYSDNPHSKTRIFGRELTRIIPNSLSRYRQRSSVKRIVQSA 458 +LD ++S+ P + ++ + + R T + + +Y+QR K +QS Sbjct: 206 KLDHSDPVLDSSFTPLMTLSPENRRQNNATSSTRPSTCKTNSYVRKYKQRKGKKFEIQSY 265 Query: 459 IREDVTDVIIINENQRQPN 515 + + D++ + E + P+ Sbjct: 266 LEIEQPDIVALPETKIDPS 284 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.5 bits (58), Expect = 6.9 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 7/57 (12%) Frame = +3 Query: 162 EGDDVPKKIPHTLETL----REKDETMLVNADTEE---QEEAQKDMELDELSTYYEN 311 E DD+ K+ T ETL +ET ++TE+ E +++D ++EL T EN Sbjct: 3146 ERDDLKAKLEETEETLASTKENLEETSTKLSETEKLRSSEVSERDSSIEELRTNNEN 3202 >SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 27.5 bits (58), Expect = 6.9 Identities = 20/84 (23%), Positives = 31/84 (36%) Frame = +3 Query: 219 DETMLVNADTEEQEEAQKDMELDELSTYYENSYEPKVLITYSDNPHSKTRIFGRELTRII 398 DE N D + +++ S + Y+PK T PH I G L + + Sbjct: 187 DENTKSNIDFKNYSYSERPTSAPPASGFVPRLYDPKTFATVLKAPHGSVPIPG--LAQFV 244 Query: 399 PNSLSRYRQRSSVKRIVQSAIRED 470 S +SV + VQ + D Sbjct: 245 DKVTSSVPVAASVMKGVQVLAKRD 268 >SB_56934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2541 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +1 Query: 217 KMRRCSLMLTPRNKRRHKKIWNLMNFQHTMRIRMSQKC*SHTLI-IHTVKLEYSEEN*LG 393 K + C ++ +P + + ++ +N M+ +H MR +K H L+ + + ++ + N LG Sbjct: 172 KNQNCRILSSPEARHKRRR-YNSMDDKHPMRAMSPRKSKDHALLAMASANMKNNHFNFLG 230 Query: 394 L 396 + Sbjct: 231 M 231 >SB_48724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/43 (25%), Positives = 26/43 (60%) Frame = +3 Query: 240 ADTEEQEEAQKDMELDELSTYYENSYEPKVLITYSDNPHSKTR 368 ++ E+++ Q+D+E + N+ E ++L+T S+ H +T+ Sbjct: 48 SEEEQKQSEQEDLEQQLNKIHPHNTGEHQILVTPSNGMHVQTK 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,475,159 Number of Sequences: 59808 Number of extensions: 255704 Number of successful extensions: 935 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -