BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30280 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.2 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 22 2.8 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 4.9 Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 21 8.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 508 SMSTVEEVQFVWLNSGTLLVMVQMLWVVFFRIC 410 S+ VE VQ++WL L+ W+ R C Sbjct: 112 SLPEVERVQWIWLLIFAYLIPEVGTWIRAVRKC 144 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 508 SMSTVEEVQFVWLNSGTLLVMVQMLWVVFFRIC 410 S+ VE VQ++WL L+ W+ R C Sbjct: 112 SLPEVERVQWIWLLIFAYLIPEVGTWIRAVRKC 144 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 327 SKPRPG*SSRSARKP 283 SKPRP +SR+A +P Sbjct: 256 SKPRPAPASRNAPEP 270 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 4.9 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -2 Query: 206 TPQFTPRHFGHEFTHRDPQASPHNHSRSN 120 +P +P + HE+ + A+ H H+ S+ Sbjct: 269 SPSASPLAYQHEYNSFNWTANGHGHNTSS 297 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -3 Query: 463 GTLLVMVQMLWVVF 422 GT++V+V+ +WV F Sbjct: 25 GTIVVVVRGVWVSF 38 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,318 Number of Sequences: 336 Number of extensions: 2277 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -