BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30280 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0468 - 22490672-22491697,22496010-22496068,22496160-22496571 32 0.31 04_04_0822 + 28352941-28353825,28353863-28354016,28354714-283547... 30 0.96 03_05_0085 - 20638769-20639150,20640054-20640286 28 3.9 10_08_0106 + 14842748-14843085,14843122-14843250,14844145-148442... 27 6.8 03_02_0596 + 9714022-9714065,9714799-9714868,9714978-9715883,971... 27 8.9 >01_05_0468 - 22490672-22491697,22496010-22496068,22496160-22496571 Length = 498 Score = 31.9 bits (69), Expect = 0.31 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 4/75 (5%) Frame = +2 Query: 299 RDDQPGRGLLHPRSRHLREAGSGARERSL*TGQD--EYITNTEEHYPE--HLDHDQERAT 466 R Q R L R R L S AR R+L T D +++ E+ E +L ER T Sbjct: 116 RQPQQPRRPLRLRKRDLSPLNSSARPRALPTPDDGLRILSSNEDVVKEAKYLRETNERLT 175 Query: 467 VQPHELDFLHC*HAE 511 Q +L HC H E Sbjct: 176 RQIEQLHADHCAHVE 190 >04_04_0822 + 28352941-28353825,28353863-28354016,28354714-28354754, 28355060-28355310,28355411-28355591,28356138-28356323, 28356396-28356569,28356992-28357150,28357424-28357501, 28357612-28357748,28357980-28358044,28358115-28358148, 28358216-28358372,28359135-28359196,28360041-28360118, 28360940-28361042 Length = 914 Score = 30.3 bits (65), Expect = 0.96 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +3 Query: 90 DSFDLRHFY*VRS*VIVGRRLRVAVCKLVSEMSRRELRSDRIEYPAPPPSK 242 D FD+ R GRRL AV L E EL D ++P P P++ Sbjct: 138 DDFDIPSSRTSRPRRTAGRRLATAVADLSEEDDDLELADDDFDHPDPRPTR 188 >03_05_0085 - 20638769-20639150,20640054-20640286 Length = 204 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 350 EDDGSEDAVSHDQADHHEVRE 288 ED G +A+ + ADHH+V + Sbjct: 125 EDQGHSEAIQDEDADHHQVND 145 >10_08_0106 + 14842748-14843085,14843122-14843250,14844145-14844211, 14847177-14847324,14847998-14848097,14848306-14848384, 14848527-14848687,14848829-14848908,14849319-14849475, 14849575-14849723,14849909-14850076,14850426-14850719, 14851002-14851046,14851213-14851462,14851707-14851835, 14852799-14853039,14853977-14854642 Length = 1066 Score = 27.5 bits (58), Expect = 6.8 Identities = 20/56 (35%), Positives = 25/56 (44%) Frame = +2 Query: 293 ALRDDQPGRGLLHPRSRHLREAGSGARERSL*TGQDEYITNTEEHYPEHLDHDQER 460 A+ +D GR H R RH REA + A ER D Y E+ E H + R Sbjct: 969 AVAEDNDGR---HHR-RHHREAAAAAEERRRPAAGDYYGEEEEDDESEEEQHFKRR 1020 >03_02_0596 + 9714022-9714065,9714799-9714868,9714978-9715883, 9715973-9716146,9716260-9716373,9716975-9717033, 9717170-9717236,9717305-9717356,9718070-9718488, 9718786-9718847,9719305-9719374,9719730-9719831, 9719933-9720063,9720492-9720606,9720792-9720827 Length = 806 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 150 LRVAVCKLVSEMSRRELRSDRIE 218 L+V +CKL+ E ELRS+ +E Sbjct: 639 LKVELCKLLEEKRSAELRSEELE 661 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,195,034 Number of Sequences: 37544 Number of extensions: 271035 Number of successful extensions: 750 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -