BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30279 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 54 7e-08 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 54 7e-08 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 54 7e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 54 7e-08 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 54 7e-08 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 2e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 48 6e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 48 6e-06 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 6e-05 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 38 0.005 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) 29 3.0 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 4 SHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 60 SHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 628 SHDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 39 SHDVVKRRPVNCNTTHYRANW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 41 SHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 1879 SHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 39 SHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 33 SHDVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 82 SHDVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 60 SHDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 71 SHDVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 47 SHDVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRANW 454 SHDVVKRRPVNCNTTHYRANW Sbjct: 71 SHDVVKRRPVNCNTTHYRANW 91 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 513 HDVVKRRPVNCNTTHYRANW 454 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 513 HDVVKRRPVNCNTTHYRANW 454 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRAN 457 SHDVVKRRPVNCNTTHYRAN Sbjct: 21 SHDVVKRRPVNCNTTHYRAN 40 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 47.6 bits (108), Expect = 6e-06 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = +1 Query: 433 TRGGARYPIRPIVSRITIHWPSFYNVVT 516 T GGA PIRPIVS ITIHWPSFYN VT Sbjct: 36 TVGGA--PIRPIVSHITIHWPSFYNGVT 61 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = +1 Query: 433 TRGGARYPIRPIVSRITIHWPSFYNVVT 516 T GGA PIRPIVSRITIHWP+FYN T Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPT 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 44.4 bits (100), Expect = 6e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 516 SHDVVKRRPVNCNTTHYRAN 457 SHD KRRPVNCNTTHYRAN Sbjct: 78 SHDGEKRRPVNCNTTHYRAN 97 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 457 IRPIVSRITIHWPSFYNVVT 516 +RP+VSRITIHW SFYNVVT Sbjct: 33 LRPVVSRITIHWTSFYNVVT 52 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 40.7 bits (91), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 463 PIVSRITIHWPSFYNVVT 516 P +SRITIHWPSFYNVVT Sbjct: 77 PYMSRITIHWPSFYNVVT 94 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 457 IRPIVSRITIHWPSFY 504 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVVT 516 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVV 513 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.7 bits (76), Expect = 0.046 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 472 SRITIHWPSFYNVV 513 SRITIHWPSFYNV+ Sbjct: 2 SRITIHWPSFYNVM 15 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 487 HWPSFYNVVT 516 HWPSFYNVVT Sbjct: 5 HWPSFYNVVT 14 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 487 HWPSFYNVVT 516 HWPSFYNVVT Sbjct: 62 HWPSFYNVVT 71 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 487 HWPSFYNVVT 516 HWPSFYNVVT Sbjct: 5 HWPSFYNVVT 14 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 487 HWPSFYNVVT 516 HWPSFYNVVT Sbjct: 57 HWPSFYNVVT 66 >SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) Length = 1650 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 282 NVRCRRLESTLVSDVGHSVSNTVRADVRKFSANLKSFVFS 163 N+ R+ + DV S NTV+ D++ +LKSFV S Sbjct: 894 NLVALRIAGRVPQDVTGSTRNTVQKDIQGIEDSLKSFVES 933 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,083,622 Number of Sequences: 59808 Number of extensions: 230105 Number of successful extensions: 3272 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 3213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3270 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -