BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30277 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 3.5 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 4.6 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.8 bits (49), Expect = 3.5 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +1 Query: 352 IKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLN---SQVNDLRGKFVKPTLKKV 516 +K+VC YH + +E + E +++ I DL Q D R + + K+V Sbjct: 228 VKKVCAGYHASLYPCPNEYNEREEMLRGVRTRIEDLKMVLGQTQDQRQRVLLNVAKEV 285 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 4.6 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +1 Query: 313 GKPKNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKF 492 G+ + + A + T K + +R L ++ L R++ S+ NS+ ++ +F Sbjct: 1149 GRYEARNPAYQRTTKDLFSGNQQRTQELVNQNETLSCYTSRRNSTTSNANSEPQEVAPQF 1208 Query: 493 VK 498 VK Sbjct: 1209 VK 1210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 361,334 Number of Sequences: 2352 Number of extensions: 4932 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -