BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30276 (426 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pom... 25 3.7 SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce... 25 3.7 SPAC1002.21 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 4.9 SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo... 25 4.9 SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1 |Schiz... 24 8.6 >SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 992 Score = 25.4 bits (53), Expect = 3.7 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +2 Query: 86 CDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNA--SKAEASLAESG 235 CD+ + S G L H + R GG + + + N+ SK E +A SG Sbjct: 601 CDACLNLGTHSESIGDLEHQIRRYTGGISISPSAVTNNSDVSKYELGIAISG 652 >SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.4 bits (53), Expect = 3.7 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 158 AGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 283 A A+ +A A +AEA E+ K+++ EP+++ +K+ Sbjct: 89 AAEAEAAAAARAAAAKEAEAKRLEAAKNIVLKEPKDAPAAKK 130 >SPAC1002.21 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 148 Score = 25.0 bits (52), Expect = 4.9 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 86 CDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNASK 208 C A + +S G +VHA RAA + A CL K Sbjct: 54 CLHRCAFLDLTKSRGRVVHACSRAALPRAIADASHCLEEKK 94 >SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 25.0 bits (52), Expect = 4.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 137 PNVRNCGSSRTEQYYYRNDKPSVG 66 P V N GSSRT+ +Y R + G Sbjct: 86 PRVINLGSSRTDWFYERKKFKNAG 109 >SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 451 Score = 24.2 bits (50), Expect = 8.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 110 ERNRSFGHLVHALGRAAGGAKLPSAGLCLNASKAEAS 220 E +SF L + + A G +K+P A + L S+ E S Sbjct: 153 ESAKSFAALSNVVRSALGKSKVPQAAVQLVQSREEVS 189 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,548,524 Number of Sequences: 5004 Number of extensions: 27633 Number of successful extensions: 63 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 152416050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -