BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30273 (471 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1236 + 25454371-25456801,25456891-25457177,25457258-254574... 35 0.038 01_06_1656 + 38946922-38947542,38947640-38947739,38948045-389481... 34 0.067 04_04_0258 + 23988409-23989580,23990450-23990851,23991138-23991204 31 0.62 08_01_0186 - 1561695-1561958,1562041-1562183,1562260-1562326,156... 29 1.4 05_07_0329 - 29308867-29308932,29309040-29309159,29309245-293093... 29 1.9 01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430... 29 2.5 05_04_0411 + 21057838-21058878,21059723-21059926,21060011-21060238 28 3.3 01_01_1220 + 9862195-9862281,9862427-9862646,9862764-9862916,986... 28 3.3 12_02_0800 + 23299674-23299678,23299714-23299791,23299876-232999... 28 4.4 12_01_0945 + 9351915-9351929,9352221-9352386,9352903-9353024,935... 27 5.8 12_02_0238 - 16099652-16099741,16099814-16100257 27 7.6 07_01_0251 + 1874148-1874311,1874367-1874429,1874484-1874709,187... 27 7.6 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 27 7.6 03_01_0146 - 1161005-1161133,1161239-1161283,1161369-1161469,116... 27 7.6 02_04_0463 + 23135732-23136888,23138956-23139333,23139506-23139530 27 7.6 01_05_0677 - 24202037-24202444,24202499-24202795,24202960-242030... 27 7.6 >08_02_1236 + 25454371-25456801,25456891-25457177,25457258-25457416, 25457561-25457740,25457823-25458017,25459059-25459157, 25459508-25460137,25460250-25460591 Length = 1440 Score = 34.7 bits (76), Expect = 0.038 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 5/116 (4%) Frame = +2 Query: 5 TISKXRQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKHPPKIQVASKYERRV--- 175 +IS +KR D+KELK ++KQ + K + +H + Q K + V Sbjct: 971 SISLKEEKRLLQDIKELKAQKKQLSSNMGSKAEMGEAFEQKEHIHEQQKILKKDSDVLLT 1030 Query: 176 DTRSYDDKKKLFEGDLEKLNKDFLEKVWQERAEQFGGRQKARLPKWF--GERPGKK 337 + +S +DK + + + +D L K+ +E RQKA +WF + PG+K Sbjct: 1031 NLKSLEDKTRFIKKAFDD-ERDALRKLTEEHQAAHEVRQKA-YDEWFELKKEPGRK 1084 >01_06_1656 + 38946922-38947542,38947640-38947739,38948045-38948189, 38948868-38948991,38949443-38949960,38950111-38950458, 38950557-38950638,38951309-38951707,38951790-38951927, 38952063-38952108,38952200-38952369 Length = 896 Score = 33.9 bits (74), Expect = 0.067 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 1/93 (1%) Frame = +2 Query: 2 NTISKXRQKRQDYDLKELKERQKQQLRHKALKKGLDPEAL-TGKHPPKIQVASKYERRVD 178 +T K QK Q KELK+++K++ R + +K EAL K K + K ++R Sbjct: 328 STNEKDTQKAQKQVEKELKQKEKEEARMRKQQKKQQEEALREQKRREKEEAEMKKQQRKQ 387 Query: 179 TRSYDDKKKLFEGDLEKLNKDFLEKVWQERAEQ 277 ++K E + + K +K QE AE+ Sbjct: 388 EEEAQKEQKRREKEEAETRKQ--QKKQQEEAEK 418 >04_04_0258 + 23988409-23989580,23990450-23990851,23991138-23991204 Length = 546 Score = 30.7 bits (66), Expect = 0.62 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 28 ETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNSSSV 156 E GL ++ + + + T +S + SRP SAH P S V Sbjct: 300 EKGLDWRKMETEIEQKTSRPTSSQSSRPNSAHSSRPGSPGSQV 342 >08_01_0186 - 1561695-1561958,1562041-1562183,1562260-1562326, 1562417-1562529,1562603-1562671,1563831-1563870, 1563965-1564035,1565872-1566027,1566104-1566152, 1566228-1567631 Length = 791 Score = 29.5 bits (63), Expect = 1.4 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 10 LEXEAKETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNSSSVQVRE 168 ++ EAK KRA+ A A++ ++ R R A R+A Q +V + E Sbjct: 661 IQAEAKAAEDARKRAEAAAAAEAAAEAKRQREREREAARKALQQMEKTVDINE 713 >05_07_0329 - 29308867-29308932,29309040-29309159,29309245-29309364, 29309566-29310123,29310199-29310258,29310839-29310904, 29310993-29311103,29311167-29311257,29311349-29311449, 29311534-29311641,29311737-29314205 Length = 1289 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +2 Query: 14 KXRQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGK 130 + +++ ++ +E K R+K++ + K LKK + + LTGK Sbjct: 457 RLKKEEEERKAEEAKRRKKEREKEKLLKKKQEGKLLTGK 495 >01_05_0487 + 22641133-22642182,22642276-22642863,22642961-22643068, 22643582-22643692,22643784-22643849,22644858-22644917, 22644990-22645119,22645159-22645547,22645783-22645902, 22645957-22646022,22646190-22646255 Length = 917 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +2 Query: 23 QKRQDYDL-KELKERQKQQLRHKALKKGLDPEALTGK 130 Q+ +D + +E+K +QK++ + K +KK D + LTGK Sbjct: 207 QREEDERMVEEMKMQQKERDKGKTMKKRQDGKTLTGK 243 >05_04_0411 + 21057838-21058878,21059723-21059926,21060011-21060238 Length = 490 Score = 28.3 bits (60), Expect = 3.3 Identities = 18/75 (24%), Positives = 34/75 (45%) Frame = +1 Query: 40 RLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNSSSVQVREACRHTILRRQKETVRG* 219 R K +TKA+ EA Q+G R + R+ + + LR+++E R Sbjct: 417 RSKTEAARTKASQEAFREQQGLRQEALQRKKAEKKKLMEEAEAKLSAEALRKKEEKERA- 475 Query: 220 PRETEQGLPREGVAR 264 R+ ++ +P+ + R Sbjct: 476 -RQMKKSMPKVKMLR 489 >01_01_1220 + 9862195-9862281,9862427-9862646,9862764-9862916, 9863016-9863674,9863749-9863852,9863950-9864192, 9864262-9864376,9864696-9864909,9864995-9865511, 9866439-9866448,9867363-9867551,9867755-9868084, 9868639-9868872,9869303-9869743 Length = 1171 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 221 GHPRTVSFCRRRIVCRHASRTWTLLEFWAG 132 GH R VS R R + H +R+W L+ +G Sbjct: 103 GHERVVSVFRDRALELHTTRSWDFLDVQSG 132 >12_02_0800 + 23299674-23299678,23299714-23299791,23299876-23299920, 23300052-23300415,23300493-23300574,23300793-23300873, 23300974-23302106,23302202-23302350,23302426-23302516, 23303628-23305940 Length = 1446 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 68 KQQLRHKALKKGLDPEALTGKHPP 139 K+ RH KK +D +T KHPP Sbjct: 882 KKSARHSRNKKKVDEAPVTSKHPP 905 >12_01_0945 + 9351915-9351929,9352221-9352386,9352903-9353024, 9353098-9353214,9356997-9357077,9357204-9357272, 9357727-9357790,9357988-9358067,9358164-9358247, 9358418-9358502,9359658-9359743,9359924-9360045, 9360841-9360901,9360981-9361166,9363622-9363723, 9363803-9363844,9363949-9364086 Length = 539 Score = 27.5 bits (58), Expect = 5.8 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = -2 Query: 266 SLATPSRGSPCSVSLGHPRTVSFCRR---RIVCRHASRTWTLLEFWAGACL*ALRGRD 102 S+ PS + CS+ G +TV C R R+VC H R +F+ G C L RD Sbjct: 435 SILVPSDANYCSIREGRTQTVGECLRREYRMVC-HVMRGDFSRDFFEG-CRAILLDRD 490 >12_02_0238 - 16099652-16099741,16099814-16100257 Length = 177 Score = 27.1 bits (57), Expect = 7.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 293 FACRRTVRPSLATPSRGSPC 234 F RR P L TP+R +PC Sbjct: 6 FMARRRGNPELVTPARATPC 25 >07_01_0251 + 1874148-1874311,1874367-1874429,1874484-1874709, 1874830-1875081,1875158-1875267,1875720-1875815, 1875898-1875985,1876246-1876475,1876745-1876929, 1877136-1877335,1877592-1877924,1878058-1878159, 1878869-1879166,1879626-1879774,1879859-1880143, 1880531-1880728 Length = 992 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 155 SKYERRVDTRSYDDKKKLFEGDLEKLNKDFLEKVWQ 262 +KYE ++ SYDD K+ G++ K F K WQ Sbjct: 633 NKYETKIAYPSYDDSSKIALGNILK----FRRKNWQ 664 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 27.1 bits (57), Expect = 7.6 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +2 Query: 146 QVASKYE-RRVDTRSY-DDKKKLFEGDLEKLNKDFLEKVWQERAEQFGGRQ 292 QV SK + DT SY DD+ L G L N DF V +R + GR+ Sbjct: 940 QVTSKTDVSSGDTSSYQDDQSSLHGGSLPWKNTDFESTVDFDRQLPYDGRE 990 >03_01_0146 - 1161005-1161133,1161239-1161283,1161369-1161469, 1161585-1161691,1161823-1161924,1162028-1162250, 1162343-1162382 Length = 248 Score = 27.1 bits (57), Expect = 7.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = +1 Query: 7 DLEXEAKETGLRLKRAQRKTKAAT 78 DL+ + +ET +L+RAQ+K K+ T Sbjct: 193 DLDEKTEETSNQLQRAQKKLKSVT 216 >02_04_0463 + 23135732-23136888,23138956-23139333,23139506-23139530 Length = 519 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 28 ETGLRLKRAQRKTKAATEAQSSQEGSRPRSAHRQAPAQNSS 150 E GL ++ + + T +S + SRP SAH P S Sbjct: 295 EKGLDWRKMETEIDHKTSRPTSSQSSRPGSAHSSLPGSPGS 335 >01_05_0677 - 24202037-24202444,24202499-24202795,24202960-24203009, 24204534-24204589,24205751-24206040,24206100-24206488, 24210578-24210818 Length = 576 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 109 PRSAH-RQAPAQNSSSVQVREACRHTILRRQKETVRG*PRE 228 PR+ H R+AP + V +R ++TILR + +R PR+ Sbjct: 329 PRTRHGRRAPTPDPFVVNMRNPAQYTILRHHDQFLR--PRD 367 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.125 0.340 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,528,514 Number of Sequences: 37544 Number of extensions: 132571 Number of successful extensions: 692 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -