BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30263 (308 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Pl... 25 3.4 SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosac... 24 4.5 >SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Plh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 623 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 210 SVPSXELGSACXKIGSSSEVQPASPSFHKYSI 115 ++P LG C K+ + PA+ S Y I Sbjct: 528 TLPILALGLVCNKVWQTKRFNPANTSITNYEI 559 >SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2670 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 269 SNQALASFVKYITYVIFXNFQY 204 SNQ L F KY+ ++F +F + Sbjct: 678 SNQELVDFDKYLVELLFLSFAF 699 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 810,598 Number of Sequences: 5004 Number of extensions: 8722 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 79841814 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -