BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30263 (308 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) 26 5.4 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 26 7.2 >SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) Length = 3083 Score = 26.2 bits (55), Expect = 5.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 195 ELGSACXKIGSSSEVQPASPSFHKYSIIFXRC 100 E+ C + S + + A P FHKY I +C Sbjct: 380 EMQQNCSLVASIATFRDACPGFHKYLNIQYKC 411 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 25.8 bits (54), Expect = 7.2 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -3 Query: 162 SSEVQPASPSFHKYSIIFXRCC 97 S + +P++P FH++S+ CC Sbjct: 222 SLQDRPSTPDFHRFSLNAVSCC 243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,079,820 Number of Sequences: 59808 Number of extensions: 68831 Number of successful extensions: 185 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 389827759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -