BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30246 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 28 0.16 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 27 0.38 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 27 0.50 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 1.5 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 3.5 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 23 4.6 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.1 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 6.1 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 8.1 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 28.3 bits (60), Expect = 0.16 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGE 498 +G P RS + +P P P PPS P +PR T + + PQL E Sbjct: 766 TGMPSPSRSAFADGIGSP-PPPPPPPPSSLSPGGVPRPTVL--QKLDPQLSEE 815 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 27.1 bits (57), Expect = 0.38 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 33 SASERNGPIAYVRSDPAEGFSRDQLGTTACGRRRP 137 S E + PI+ +PA+G R ++GT R P Sbjct: 60 SIDENDEPISDAEEEPAKGSKRRKVGTVTKAYREP 94 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 26.6 bits (56), Expect = 0.50 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +1 Query: 289 QIKLVIQRDV--EREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV 462 Q+ LV Q+ + E++ S AP + PNA+ TP PP+ P S +T + Sbjct: 42 QLNLVHQQQLALEQQSAAISTNTAAPGTAGPNAATVTAATPQ--PPAASMPPSTTTNTQI 99 Query: 463 P 465 P Sbjct: 100 P 100 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.0 bits (52), Expect = 1.5 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 217 KIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRS 366 ++ D +AR A+N +NA + QR+++R G R P +PR+ Sbjct: 1029 EVADLEARRAEIRRARNDRRNASRRAARARQRELQRAG-RPPSPPPSPRT 1077 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 3.5 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGP 435 GS TP + +P P +A SPL S + P Sbjct: 767 GSNTPNSAAAPHPYYTAAAMAAASPLSLSSKAP 799 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 92 ESLRRVTTNVCNRPIAFGCTCANALLRG*Y 3 E++RR C + GC C N +R Y Sbjct: 78 ENIRRGDHLACTKHCVEGCFCRNGYVRDKY 107 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 316 VEREGLRGSGTPLAPRSPIPN 378 + R+ L S P+AP SP PN Sbjct: 687 LSRKLLTESAPPIAPMSPRPN 707 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 192 VPAGRSTWRHPCDNEW 145 +P GRST + C EW Sbjct: 250 LPVGRSTGQMKCREEW 265 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 22.6 bits (46), Expect = 8.1 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 SG PR P+P P P + P++ T PPS Sbjct: 292 SGMVGPPRPPMPMQGGAPGGPPQGMRPNFYNRPMGDPQTSRPPS 335 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Frame = +1 Query: 373 PNA---SATPFRTPSPLPPSWRGPESL 444 PNA A+P ++PS +P R PE++ Sbjct: 587 PNALASPASPLKSPSKIPGLARRPENI 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,693 Number of Sequences: 2352 Number of extensions: 13067 Number of successful extensions: 47 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -