BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30246 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.021 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 35 0.037 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 35 0.037 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 34 0.049 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 34 0.065 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.086 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.11 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.15 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 32 0.20 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 32 0.20 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 32 0.26 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 31 0.35 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 31 0.35 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 31 0.35 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 31 0.46 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 31 0.46 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 0.46 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 31 0.61 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 31 0.61 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 31 0.61 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 0.61 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 31 0.61 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 30 0.80 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 30 0.80 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 30 0.80 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 30 0.80 At2g18470.1 68415.m02151 protein kinase family protein contains ... 30 0.80 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 30 0.80 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 30 0.80 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 0.80 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 30 1.1 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 30 1.1 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 1.1 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 30 1.1 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 30 1.1 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 30 1.1 At4g11260.1 68417.m01822 phosphatase-related low similarity to p... 30 1.1 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 30 1.1 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 30 1.1 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 30 1.1 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 30 1.1 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 30 1.1 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 29 1.4 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 29 1.4 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 29 1.4 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 29 1.4 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 29 1.4 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 29 1.4 At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family... 29 1.4 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 1.4 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 1.4 At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a '... 29 1.4 At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a '... 29 1.4 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 29 1.9 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 1.9 At3g32904.1 68416.m04164 hypothetical protein 29 1.9 At3g07130.1 68416.m00849 serine/threonine protein phosphatase fa... 29 1.9 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 29 1.9 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 29 1.9 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 29 1.9 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 29 1.9 At1g10620.1 68414.m01204 protein kinase family protein contains ... 29 1.9 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 29 2.5 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 29 2.5 At4g01810.1 68417.m00238 protein transport protein-related relat... 29 2.5 At3g57380.1 68416.m06387 expressed protein contains Pfam domain,... 29 2.5 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 2.5 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 2.5 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 2.5 At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein ... 29 2.5 At1g61080.1 68414.m06877 proline-rich family protein 29 2.5 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 29 2.5 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 2.5 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 29 2.5 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 3.2 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 28 3.2 At3g16770.1 68416.m02141 AP2 domain-containing protein RAP2.3 (R... 28 3.2 At2g19870.1 68415.m02323 tRNA/rRNA methyltransferase (SpoU) fami... 28 3.2 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 28 3.2 At1g78310.1 68414.m09126 VQ motif-containing protein contains PF... 28 3.2 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 28 3.2 At1g03780.1 68414.m00359 targeting protein-related similar to mi... 28 3.2 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 28 3.2 At5g58770.1 68418.m07361 dehydrodolichyl diphosphate synthase, p... 28 4.3 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 28 4.3 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 28 4.3 At3g18810.1 68416.m02389 protein kinase family protein contains ... 28 4.3 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 28 4.3 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 28 4.3 At5g52680.1 68418.m06540 heavy-metal-associated domain-containin... 27 5.7 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 27 5.7 At5g03150.1 68418.m00263 zinc finger (C2H2 type) family protein ... 27 5.7 At5g01040.1 68418.m00007 laccase family protein / diphenol oxida... 27 5.7 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 27 5.7 At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-conta... 27 5.7 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 27 5.7 At3g57180.1 68416.m06366 expressed protein 27 5.7 At3g24540.1 68416.m03082 protein kinase family protein contains ... 27 5.7 At2g40760.1 68415.m05028 rhodanese-like domain-containing protei... 27 5.7 At2g40070.1 68415.m04923 expressed protein 27 5.7 At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 27 5.7 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 27 5.7 At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 27 5.7 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 27 5.7 At5g18840.1 68418.m02239 sugar transporter, putative similar to ... 27 7.5 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 27 7.5 At4g13700.1 68417.m02128 serine/threonine protein phosphatase fa... 27 7.5 At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyc... 27 7.5 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 27 7.5 At3g28790.1 68416.m03593 expressed protein 27 7.5 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 27 7.5 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 27 7.5 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 27 7.5 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 27 7.5 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 27 7.5 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 27 7.5 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 27 7.5 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 27 9.9 At4g09980.1 68417.m01634 methyltransferase MT-A70 family protein... 27 9.9 At3g60900.1 68416.m06813 fasciclin-like arabinogalactan-protein ... 27 9.9 At3g23030.1 68416.m02903 auxin-responsive protein / indoleacetic... 27 9.9 At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica... 27 9.9 At1g12090.1 68414.m01399 protease inhibitor/seed storage/lipid t... 27 9.9 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 35.5 bits (78), Expect = 0.021 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 S P A P P A+ P P PLPP P S P++TP PP P L Sbjct: 123 SPPPPAITPPPPLATTPPALPPKPLPP----PLSPPQTTPPPPPAITPPL 168 Score = 34.7 bits (76), Expect = 0.037 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P SP P A+ P P PLPP P S P++TP PP P Sbjct: 72 PPQSTSPPPVATTPPALPPKPLPP----PLSPPQTTPPPPPAITP 112 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 388 TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 +P +P PLPP P P++TP PP P L Sbjct: 257 SPTISPPPLPPQTLKPPP-PQTTPPPPPAITPPL 289 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 34.7 bits (76), Expect = 0.037 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 ++P +PIP+ +TP +P P P P P+ +P PPS Sbjct: 75 ISPSTPIPSTPSTP--SPPPPAPKKSPPPPTPKKSPSPPS 112 Score = 30.7 bits (66), Expect = 0.61 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 TP P P P S +P TPS PP+ + S P P P + P Sbjct: 114 TPFVPH-PTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPP 158 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 34.7 bits (76), Expect = 0.037 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 349 PLAPRS-PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P AP+ P P+ P TP P+PP P+ P TP P + P Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 31.1 bits (67), Expect = 0.46 Identities = 19/49 (38%), Positives = 22/49 (44%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 S P+AP P P S P P P PP P P P PP + QP+ Sbjct: 19 SSKPVAPPGPSPCPSPPP--KPQPKPP----PAPSPSPCPSPPPKPQPK 61 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 S P+AP P A P +P P PP P+ P +P P Sbjct: 9 SPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSP 50 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P P+ P P P P P P P P+ P PP Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 34.3 bits (75), Expect = 0.049 Identities = 20/40 (50%), Positives = 23/40 (57%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 SP P+ SA P R+P PP P SLP+ TP PP F P Sbjct: 225 SPPPSPSAPPPRSP---PPKSSPPSSLPQ-TPSPPLVFTP 260 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 33.9 bits (74), Expect = 0.065 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 PR+ P S TP TP+P P S P +P+P S P Sbjct: 40 PRTAAPTPSITPTPTPTPSATPTAAPVSPPAGSPLPSSASPP 81 Score = 31.9 bits (69), Expect = 0.26 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 TP +P P SATP T +P+ P P S P PP+ P Sbjct: 46 TPSITPTPTPTPSATP--TAAPVSPPAGSPLPSSASPPAPPTSLTP 89 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.5 bits (73), Expect = 0.086 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPR-STPVPPSQFQP 483 +P AP +P P + TP SP P+ +GP + P STP PS +P Sbjct: 81 SPSAPITPSPPSPTTPSNPRSPPSPN-QGPPNTPSGSTPRTPSNTKP 126 Score = 29.9 bits (64), Expect = 1.1 Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPS-WRGPESLPRSTPVPPSQFQPQ 486 GS TP P+ P P+A TP PSP PS R P S + P PS P+ Sbjct: 71 GSLTPPLPQ-PSPSAPITP-SPPSPTTPSNPRSPPSPNQGPPNTPSGSTPR 119 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 364 SPIPNASATP-FRTPSPLPPS-WRGPESLPRSTPVPPSQFQPQLDG 495 +P P AS+ P TPS PPS S P S+P+PPS P G Sbjct: 26 TPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPG 71 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 TP +P P P+ ++T SPLPPS P S P S P Q P Sbjct: 39 TPSSP-PPSPSTNSTSPPPSSPLPPS-LPPPSPPGSLTPPLPQPSP 82 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.1 bits (72), Expect = 0.11 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Frame = +1 Query: 343 GTPLAPRSPIPN----ASATPFRTPSPLPPSWRGPESLPR---STPVPPSQFQPQL 489 G+P +P SP P+ + TP P+P+ P P +P + P PPS P L Sbjct: 544 GSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPL 599 Score = 31.9 bits (69), Expect = 0.26 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASA-TPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 G P +P +P P S +P +PSP P + P S P S PPS P Sbjct: 504 GGSPPSSPTTPSPGGSPPSPSISPSP-PITVPSPPSTPTSPGSPPSPSSP 552 Score = 31.1 bits (67), Expect = 0.46 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 TP +P SP +S TP +P P PP+ P + P TP+ P Q P + Sbjct: 539 TPTSPGSPPSPSSPTP-SSPIPSPPT---PSTPP--TPISPGQNSPPI 580 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +1 Query: 337 GSGTPLAPRSPIPNAS--ATPFRTPSP--LPPSWRGPESLPRSTPVPPS 471 G P +P +P P S ++P TPSP PPS S P + P PPS Sbjct: 491 GGSPPSSPTTPTPGGSPPSSP-TTPSPGGSPPSPSISPSPPITVPSPPS 538 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P+ SP P+ +P PSP P+ P P + PP+ P Sbjct: 530 PITVPSP-PSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISP 573 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +1 Query: 328 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 G G G P +P+ TP +P PPS S P + P PP+ P Sbjct: 396 GSFGCGRSTRPPVVVPSPPTTP--SPGGSPPSPSISPSPPITVPSPPTTPSP 445 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 + P P P+ + P TP+P PS P + + P PPS Sbjct: 198 VTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPS 237 Score = 31.1 bits (67), Expect = 0.46 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP--PSQFQP 483 TP P SP P S P TP+P PS P S P TP P PS P Sbjct: 87 TPSVP-SPTPPVSPPP-PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 132 Score = 31.1 bits (67), Expect = 0.46 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP--PSQFQP 483 TP P SP P S P TP+P PS P S P TP P PS P Sbjct: 105 TPSVP-SPTPPVSPPP-PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 150 Score = 30.7 bits (66), Expect = 0.61 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P +P P+ + P TP+P PS P P TP PP+ P Sbjct: 185 PPTPTPSVPSPPDVTPTPPTPSVPSP---PDVTPTPPTPSVP 223 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P++P P P S P TP PP S+P TP P+ P Sbjct: 132 PVSPPPPTPTPSV-PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMP 175 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLP-PSWRGPESLPRSTPVPPSQFQP 483 S TP P P+P + P P P P PS P P TP PP+ P Sbjct: 164 SPTPPVPTDPMP-SPPPPVSPPPPTPTPSVPSP---PDVTPTPPTPSVP 208 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP--PSQFQP 483 P +P+P S P P+P PS P S P TP P PS P Sbjct: 74 PPAPVPPVSPPP---PTPSVPSPTPPVSPPPPTPTPSVPSPTPP 114 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 459 P+ P SP P + P TP PP S+P TP Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTP 113 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +1 Query: 349 PLAPRSPIPNASA---TPFRTPSPLPPSWRGPESLPRSTPVPPS 471 P++P P P S TP +P P P+ P P +P PP+ Sbjct: 96 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 139 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +1 Query: 349 PLAPRSPIPNASA---TPFRTPSPLPPSWRGPESLPRSTPVPPS 471 P++P P P S TP +P P P+ P P +P PP+ Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT 157 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 TP P SP P P PSP PP P + S P PP Sbjct: 159 TPSVP-SPTPPVPTDPM--PSPPPPVSPPPPTPTPSVPSPP 196 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 +P P SP P + TP PSP PP P + S P P P Sbjct: 110 SPTPPVSP-PPPTPTP-SVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 32.3 bits (70), Expect = 0.20 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 349 PLAPRSPIPNASATPFR--TPSPLPPSWRGPESLPRSTPVPP 468 P+ P P P+ + P R TP P PP + E R TP PP Sbjct: 135 PITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPP 176 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 352 LAPRSPIPNASATPFR--TPSPLPPSWRGPESLPRSTPVPP 468 + P P P+ + R TPSP PPS S P + P PP Sbjct: 119 ITPSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPP 159 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 32.3 bits (70), Expect = 0.20 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P+ P P P+ P TPSP PPS P P TP PP Sbjct: 622 PVTPSPPPPSPVYYPPVTPSPPPPS---PVYYPPVTPSPP 658 Score = 30.7 bits (66), Expect = 0.61 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST--PVPPSQF 477 P+ P P P+ P TPSP PPS P P T P PP+++ Sbjct: 637 PVTPSPPPPSPVYYPPVTPSPPPPS---PVYYPSETQSPPPPTEY 678 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 + P P P+ P TPSP PPS P P TP PP Sbjct: 608 VTPSPPPPSPLYYPPVTPSPPPPS---PVYYPPVTPSPP 643 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P+ P P+ P TPSP PPS P P TP PP Sbjct: 592 PVTYSPPPPSPVYYPQVTPSPPPPS---PLYYPPVTPSPP 628 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 31.9 bits (69), Expect = 0.26 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSP--LPPSWRGPESLPRSTPVPPSQFQP 483 P+ +P P+ ++P TPS PPS S P S P PPS P Sbjct: 117 PVLAAAPSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLP 163 Score = 31.1 bits (67), Expect = 0.46 Identities = 22/48 (45%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSP-LPPSWR-GPESLPRSTPVPPSQFQP 483 TP P SP P+ +TP PSP PPS P SLP S PP+ P Sbjct: 134 TPSTPSSP-PSTPSTPSSPPSPPSPPSPSLPPSSLPPSAS-PPTNGTP 179 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 31.5 bits (68), Expect = 0.35 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 P+ R P+P P R +P PP G P P PP F P+ Sbjct: 16 PMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPP---PPPPPMFDPK 58 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 31.5 bits (68), Expect = 0.35 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 +P SP ++S+T +P+P P P P STP PP +F P Sbjct: 84 SPPSPTDSSSSTSI-SPNP-PAPIVNPNPPPPSTPNPPPEFSP 124 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 340 SGTPLAPRSPIP--NASATPFRTPSPLPPSWRGPESLPRST-PVPPS 471 S T ++P P P N + P TP+P P P L +T P PPS Sbjct: 93 SSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPS 139 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 31.5 bits (68), Expect = 0.35 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV--PPSQFQP 483 P P P S P P P P + P LP TP+ PP F P Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPP 98 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 31.1 bits (67), Expect = 0.46 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Frame = +1 Query: 274 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS--WRGPESLP 447 + +P Q K + R G G ++PR P+ P PSP PP+ + P +L Sbjct: 366 QRSPGQCKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPP-SLPSPPPPAPIFSTPPTL- 423 Query: 448 RSTPVPPSQFQP 483 ++P PPS P Sbjct: 424 -TSPPPPSPPPP 434 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 +P P P P + P P P PP P P P PP + P Sbjct: 437 SPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 29.5 bits (63), Expect = 1.4 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = +1 Query: 346 TPLAPRS-PIPNASATPFRTP----SPLPPSWRGPE-SLPRSTPVPPSQFQP 483 TPL P S P P A F TP SP PPS P S P P PP + P Sbjct: 400 TPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSP 451 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P P P S P P P PP + P P P PP P Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPP 483 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P P P S P P P PP + P S+P PP P Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P P P + P +P P PP P P P PP P Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLP--RSTPVPP 468 +P P +P+ + TP +P P PP P P +P PP Sbjct: 590 SPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P P P S P P P PP P P P PP + P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP-PSPPPPPPPVYSP 497 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLP--RSTPVPPS 471 S P +P P P + P P P PP P P S P PPS Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPS 526 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 +P P +S P +P+P P P P +P PP QF P Sbjct: 511 SPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSP-PPPQFSP 552 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +1 Query: 361 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 R+ +AS +P+ PSP P GP P P PP P L Sbjct: 86 RNLAESASFSPWPAPSPSPFPNGGPIESPAYPPAPPRPIPPHL 128 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 349 PLAPRSPIPNASATPF-RTPSPLPPSWRGPESLPRSTPVPPS 471 PL P P+ S+ P TPSP PP+ S P + PP+ Sbjct: 73 PLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPA 114 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPP---SWRGPESLPRSTPVPPSQFQP 483 P +P N++ P + P PP S P S P STP P SQ P Sbjct: 23 PETPSENSALPPVDSSPPSPPADSSSTPPLSEP-STPPPDSQLPP 66 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 30.7 bits (66), Expect = 0.61 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 + TP AP + P+ + +P P+ PP+ GP P S P P Sbjct: 63 AATP-APATTPPSVAPSPADVPTASPPAPEGPTVSPSSAPGP 103 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 TP +P P A+ P TP+P P P + P PPS Sbjct: 36 TPPPVATPPPVATPPPAATPAPATPP---PAATPAPATTPPS 74 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 30.7 bits (66), Expect = 0.61 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRST---PVPPSQFQPQLDGE 498 P+ R+P+P P R +PLPP P ++ R P PP P D E Sbjct: 33 PMRRRAPLPPPPPPPMRRRAPLPPP--PPPAMRRRVLPRPPPPPPPLPMFDAE 83 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P P P P R +PLPP P + R P+PP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPP--PPPPMRRRAPLPP 56 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.7 bits (66), Expect = 0.61 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 358 PRSPI-PNASATPFRTPS-PLPPSWRGPESLPRSTPVPPS 471 P P+ P+ S +P P P PP G ES P P+PP+ Sbjct: 92 PMMPMTPSTSPSPLTVPDMPSPPMPSGMESSPSPGPMPPA 131 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 30.7 bits (66), Expect = 0.61 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 PL+P P + ++P R P P P + LP +PP F P Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPP 82 Score = 30.3 bits (65), Expect = 0.80 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 PL PR +P P P PP PE PR P PP Sbjct: 68 PLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 30.7 bits (66), Expect = 0.61 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTYLL 516 P SP P P PSP PP P LP P P P D + + LL Sbjct: 73 PPSP-PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLPFASSLL 124 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 P SP P P P P PP P P P PPS Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPS 84 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P P P P + P P P PP P LP +PP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 474 P P+SP P S+ P P PP+ + S PV P++ Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPPAKKNASKNSTSAPVSPAK 205 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 SP P+ S P R+ P P R PR + PPS+ P Sbjct: 145 SPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPP 184 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +1 Query: 337 GSGTPLAPRSP------IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 G PL P P ASA P P+P PS GP P P P S Sbjct: 347 GKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGS 397 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 474 P P+SP P S+ P P PP+ + S PV P++ Sbjct: 164 PTRPKSPPPRKSSFPPSRSPPPPPAKKNASKNSTSAPVSPAK 205 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 SP P+ S P R+ P P R PR + PPS+ P Sbjct: 145 SPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPP 184 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +1 Query: 337 GSGTPLAPRSP------IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 G PL P P ASA P P+P PS GP P P P S Sbjct: 347 GKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGS 397 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 30.3 bits (65), Expect = 0.80 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPS 471 +PR P P A RT SP PPS R +PRS +P PPS Sbjct: 113 SPRVPSPRAEVP--RTLSPKPPSPRA--EVPRSLSPKPPS 148 Score = 30.3 bits (65), Expect = 0.80 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +1 Query: 352 LAPRSP-IPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLD 492 L P S +P+ TP PSP P S RG P+++ P P ++ P LD Sbjct: 178 LRPASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAE-PPTLD 226 Score = 28.7 bits (61), Expect = 2.5 Identities = 22/48 (45%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTP---SPLPPSWRG-PESL--PR-STPVPPS 471 P PR P P A A P +P PPS R P L PR +TP PPS Sbjct: 250 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPS 297 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQP 483 L+P+ P P A R+ SP PPS R LPRS +P P + +P Sbjct: 127 LSPKPPSPRAEVP--RSLSPKPPSPRA--DLPRSLSPKPFDRSKP 167 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 30.3 bits (65), Expect = 0.80 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPS 471 +PR P P A RT SP PPS R +PRS +P PPS Sbjct: 112 SPRVPSPRAEVP--RTLSPKPPSPRA--EVPRSLSPKPPS 147 Score = 30.3 bits (65), Expect = 0.80 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +1 Query: 352 LAPRSP-IPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQPQLD 492 L P S +P+ TP PSP P S RG P+++ P P ++ P LD Sbjct: 177 LRPASTRVPSQRITPHSVPSPRPSSPRGASPQAISSKPPSPRAE-PPTLD 225 Score = 28.7 bits (61), Expect = 2.5 Identities = 22/48 (45%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTP---SPLPPSWRG-PESL--PR-STPVPPS 471 P PR P P A A P +P PPS R P L PR +TP PPS Sbjct: 249 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPS 296 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRS-TPVPPSQFQP 483 L+P+ P P A R+ SP PPS R LPRS +P P + +P Sbjct: 126 LSPKPPSPRAEVP--RSLSPKPPSPRA--DLPRSLSPKPFDRSKP 166 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 30.3 bits (65), Expect = 0.80 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 SP N ++T P+P PPS P+ S+P P S P Sbjct: 18 SPPSNTNSTTSSPPAPSPPSPTPPQGDSSSSPPPDSTSPP 57 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = +1 Query: 355 APRSPIP----NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQ 474 +P SP P ++S+ P + SP P P + ++P PPSQ Sbjct: 34 SPPSPTPPQGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPSQ 77 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P SPI + P +P P PP + P P +P PP Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +1 Query: 349 PLAPR-SPIPN----ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P+ SP PN S FR P PP P P +P PP + P Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSP 518 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 S P SP P + P SP PP + P P +P PP F P Sbjct: 586 SPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSP-PPPVFSP 632 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 SP P + P SP PP + P P +P PP + P L Sbjct: 631 SPPPPVHSPPPPVYSPPPPVY-SPPPPPVKSPPPPPVYSPPL 671 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 30.3 bits (65), Expect = 0.80 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +1 Query: 331 LRGSGTPLAPRSPIPNASATPFRTPSP--LPPSWRGPESLPRSTPVPPSQFQP 483 L S P P S P +S +P +PSP PS P SL S+P PP P Sbjct: 63 LSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSP-PPLSLSP 114 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 SP P +S+ PS L PS P SL S+P PP Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPP 71 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 SP P +S+ PS L PS P SL S+P PP Sbjct: 86 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPP 120 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 7/55 (12%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATP-FRTPSPLPPSWRGPES------LPRSTPVPPSQFQP 483 S + L+P S P+ S +P +PS PPS P S P S P PP P Sbjct: 23 SSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 77 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESL-PRSTPVPPS 471 L+P SP P S +P +P P PPS SL P +P PPS Sbjct: 53 LSPSSP-PPLSLSP-SSPPPPPPSSSPLSSLSPSLSPSPPS 91 Score = 27.9 bits (59), Expect = 4.3 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPES------LPRSTPVPPSQFQP 483 S +PL+ SP + S P +PS PPS P S P S P PP P Sbjct: 74 SSSPLSSLSPSLSPSP-PSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSP 126 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.3 bits (65), Expect = 0.80 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 +P P P P S P SP PP + P P +P PPS P Sbjct: 581 SPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPP 626 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG 495 G+ + A S I + + P PLPP G +L S P+PP P G Sbjct: 158 GASSSSAALSSITESEDSVLVNPPPLPPLPDGDNALSASLPLPPLPPLPPTTG 210 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPES-----LPRSTPVPPS 471 P AP +PI + S+ P P P PP+ P+S + S P PP+ Sbjct: 714 PPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPA 759 Score = 28.3 bits (60), Expect = 3.2 Identities = 27/112 (24%), Positives = 42/112 (37%), Gaps = 6/112 (5%) Frame = +1 Query: 151 IVTRVTPGTPAGRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREG 330 I T P T + + + D+ + + + EDA L +KLV + Sbjct: 440 IDTPEKPPTDSVKKFIAEDVHSVLQINNQEQNASEDATKLLHQESPSLKLVHHSATVKPL 499 Query: 331 LRGSGTPLA-----PRSPIPN-ASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 + S +P P+SP + A F P+P PP P+ P PP Sbjct: 500 VDDSKSPENAEENFPKSPSAHDGKAISFSPPTPSPPHPVRPQLAQAGAPPPP 551 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 358 PRSPIPNASATPFRT-PSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 507 P +P P + TP + P+P P P+ P P P + + + + Y T Sbjct: 94 PPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAPGGEVEDETEFSYET 144 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLP-PSWRGPESLPRSTPVPP 468 AP+ P P + P P P P P+ P+ P+ P PP Sbjct: 25 APKPPKPKPAPAP-TPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 TP P+ P TP+P PP + P P TP P + P+ Sbjct: 82 TPPKPKPKPAPTPPNPKPTPAPTPPKPK-PAPAPAPTPAPKPKPAPK 127 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 PL P P P+ P P P P + P P S P PP P Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 27.9 bits (59), Expect = 4.3 Identities = 24/64 (37%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 301 VIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWR-GPESLPRSTPVPPSQF 477 V ++ E L PL SP P P PSP PPS P SLP P PP+ Sbjct: 1047 VAEKSTEFNPLPEDSPPLPQESPPP----LPPLPPSPPPPSPPLPPSSLP---PPPPAAL 1099 Query: 478 QPQL 489 P L Sbjct: 1100 FPPL 1103 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 349 PLAPRS--PIPNASATPFRTPSPL--PPSWRGPESLPRSTPVPPSQ 474 PL P S P P A+ P P P PP P P P PPSQ Sbjct: 1085 PLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPSQ 1130 Score = 26.6 bits (56), Expect = 9.9 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P SP P + P PS LPP P +L P PPSQ P Sbjct: 1073 PPLPPSPPPPSPPLP---PSSLPPP--PPAALFPPLPPPPSQPPP 1112 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.9 bits (64), Expect = 1.1 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPS---WRGPES-LPRSTPVPP 468 S TP P SP+P+ P +P+P P S GP+S LP P PP Sbjct: 237 SPTP-GPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +1 Query: 337 GSGTPL---APRSPIPNASATPFRTPSPLPPS---WRGPESLPRSTPVPPS 471 G +PL P SP+P P +P+P P S GP P TP P S Sbjct: 213 GPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDS 263 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 6/55 (10%) Frame = +1 Query: 337 GSGTPL---APRSPIPNASATPFRTPSPLPPS---WRGPESLPRSTPVPPSQFQP 483 G +PL P SP+P P +P+P P S GP+S P P PP P Sbjct: 185 GPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDS-PLPLPGPPPSSSP 238 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 TP P P P TP P P+ P P TP PP Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 >At4g11260.1 68417.m01822 phosphatase-related low similarity to protein phosphatase T [Saccharomyces cerevisiae] GI:897806; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 358 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = +1 Query: 193 LVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVE-REGLRGSGTPLAPRSP 369 L +G K+++Y E ++ N P K++ + D+ E + P+ P Sbjct: 74 LRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEEEKDLVQPMPPS-- 131 Query: 370 IPNASATPFRTPSPLPP 420 +P++S TP T + PP Sbjct: 132 LPSSSTTPLATEADAPP 148 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 370 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 +P S P + P+ P P P TP P S QP + Sbjct: 832 VPQVSHPPMQQPTMFMPHQAQPAPQPSFTPAPTSNAQPSM 871 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 370 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 +P S P + P+ P P P TP P S QP + Sbjct: 834 VPQVSHPPMQQPTMFMPHQAQPAPQPSFTPAPTSNAQPSM 873 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPP-SWRGPESLPRSTPVPPSQFQPQL 489 P P P S P+ P P PP + P S P P PP QP + Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYM 455 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 +P P P P P P P PP P P P PPS Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPS 419 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P + P P P P P PP + P P STP PP++ P Sbjct: 94 PPTVKPPHPKPPTKPH--PHPKPPIVKPPTKPPPSTPKPPTKPPP 136 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSW-RGPESLPRSTPVPPSQFQP 483 P P P P+ + P+ PPS + P P STP PP+ P Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP 147 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 TP P P P+ P P P P + P P TP PP Sbjct: 127 TPKPPTKPPPSTPKPPTTKPPPSTP--KPPHHKPPPTPCPP 165 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 + P +P P P TP + P P + TP PP Sbjct: 185 ITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPP 223 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 + P +P P P TP + P P + TP PP+ Sbjct: 205 ITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPT 244 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +1 Query: 346 TPLAPRSPIPNA----SATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 TP SP P + P +P P PP P+ P PP Q QP Sbjct: 543 TPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQP 592 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 P SP P P +P P PP P+ P PP Q P+ Sbjct: 517 PKPEESPKPEPPK-PEESPKPQPPKQETPKPEESPKPQPPKQETPK 561 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 S P P+ P P +P P PP P+ P PP Q P+ Sbjct: 533 SPKPQPPKQETPK----PEESPKPQPPKQETPKPEESPKPQPPKQETPK 577 >At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein (FLA8) Length = 420 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 459 P+ +P P + +P P PP+ PES P +P Sbjct: 346 PVTAPTPSPADAPSPTAASPPAPPTDESPESAPSDSP 382 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 361 RSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 +SP P + P P+P P P S P PP+ P+ Sbjct: 336 KSPSPAPAPEPVTAPTPSPAD--APSPTAASPPAPPTDESPE 375 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/74 (27%), Positives = 28/74 (37%) Frame = +1 Query: 244 LRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS 423 +R EDA+ + + P+ GS P P P+ + P TP+P PS Sbjct: 28 VRFEDAKTYYLSPPSGSHGTPPSHTPPSSNCGS-PPYDPSPSTPSHPSPPSHTPTPSTPS 86 Query: 424 WRGPESLPRSTPVP 465 P TP P Sbjct: 87 HTPTPHTPSHTPTP 100 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/74 (27%), Positives = 28/74 (37%) Frame = +1 Query: 244 LRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPS 423 +R EDA+ + + P+ GS P P P+ + P TP+P PS Sbjct: 28 VRFEDAKTYYLSPPSGSHGTPPSHTPPSSNCGS-PPYDPSPSTPSHPSPPSHTPTPSTPS 86 Query: 424 WRGPESLPRSTPVP 465 P TP P Sbjct: 87 HTPTPHTPSHTPTP 100 >At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 162 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP-VPPSQFQPQLD 492 ++P +P P ++ P +TP P P P STP + P P+ D Sbjct: 46 ISPAAPTPESTEAPAKTPVEAPVE-APPSPTPASTPQISPPAPSPEAD 92 >At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 185 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP-VPPSQFQPQLD 492 ++P +P P ++ P +TP P P P STP + P P+ D Sbjct: 46 ISPAAPTPESTEAPAKTPVEAPVE-APPSPTPASTPQISPPAPSPEAD 92 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +1 Query: 328 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 477 G R PL P ++ P T P G S P STP PP Q+ Sbjct: 239 GGRSPPLPLPPGQFTAGNASFPSSTQPPPGQYMAGNASFPSSTPPPPGQY 288 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSW--RGPESLPRSTPVPPSQF 477 P SP S P PLPP G S P ST PP Q+ Sbjct: 229 PSSPSQIHSGGGRSPPLPLPPGQFTAGNASFPSSTQPPPGQY 270 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/56 (28%), Positives = 24/56 (42%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 507 S T P + ++ P TP P G STP+PP Q+ P ++ + T Sbjct: 261 SSTQPPPGQYMAGNASFPSSTPPPPGQYMAGNAPFSSSTPLPPGQY-PAVNAQLST 315 >At1g53645.1 68414.m06102 hydroxyproline-rich glycoprotein family protein Length = 523 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/72 (26%), Positives = 25/72 (34%) Frame = +1 Query: 283 PNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPV 462 P+ I + + G G PL +PI R P P P R R+ V Sbjct: 200 PDNIFNALGNEFSHPSGAGRGKPLVESAPIRQEDNRQIRRPPPPPQQQRVQPQQKRAPTV 259 Query: 463 PPSQFQPQLDGE 498 +PQL E Sbjct: 260 KDGTPKPQLSAE 271 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 AP P +S P +P P PP+ P + P ++P PP+ P Sbjct: 108 APPPANPVSSPPPESSPPPPPPT-EAPPTTPITSPSPPTNPPP 149 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 GS P P P P+ S P P PP P P P+P + P Sbjct: 235 GSKRP-TPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSP 282 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPL---PPSWRGPESLPR----STPVPPSQFQP 483 P P TP +PSP PP P SLP S P+PP + P Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVP 174 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPR--STPVPP 468 P P P+ + P P +PPS P LP ++ +PP Sbjct: 155 PSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPP 193 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 P P S P S+ P P+ PP+ P + P PP + P L Sbjct: 111 PANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSL 157 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRG--PESLPRSTPVPPSQFQP 483 + TP P ++P PSP PS G P ++P S P PS P Sbjct: 54 TNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 391 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 507 P+ +PSP P P S+P PP + P EY++ Sbjct: 721 PYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKS 759 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 391 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 507 P+ +PSP P S+P PP+ + P EY++ Sbjct: 798 PYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKS 836 >At1g08060.2 68414.m00881 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 +AP + A+ R+P+P S+R S P +T P S PQ Sbjct: 1919 IAPTPSVTPATNPGLRSPAPHLNSYRPSSSTPVATATPTSSVPPQ 1963 >At1g08060.1 68414.m00880 MOM1 identical to MOM1 (mutation in a 'Morpheus molecule') [Arabidopsis thaliana] gi|8132770|gb|AAF73381.1| Length = 2001 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 +AP + A+ R+P+P S+R S P +T P S PQ Sbjct: 1919 IAPTPSVTPATNPGLRSPAPHLNSYRPSSSTPVATATPTSSVPPQ 1963 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 391 PFRTPSPLPPSWRGPESLPRSTPVPPSQ 474 PF+ P PPS P LP S PPSQ Sbjct: 16 PFKKPKNRPPSPPPPLPLPPSPSPPPSQ 43 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 403 PSPLPPSWRG-PESLPRSTPVPPSQFQPQLDGEY 501 P PL P +G P S+P S P P Q Q Q Y Sbjct: 109 PPPLSPDGKGSPPSVPSSPPSPKGQSQGQQQPPY 142 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P SP P+ S +P P PP P L +S PP Sbjct: 49 PSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPP 88 >At3g32904.1 68416.m04164 hypothetical protein Length = 330 Score = 29.1 bits (62), Expect = 1.9 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +1 Query: 328 GLRGSGTPLAPRSPIPNA-SATPFRTPSPLPPSWRGPESLPR--STPVPPSQFQP 483 G + GTP P +P N+ S P T P P W P S+P+ S+P P P Sbjct: 273 GFQQWGTP--PTAPQWNSPSNVPQWTIPPTTPQWGTPSSMPQWSSSPTAPQLSSP 325 >At3g07130.1 68416.m00849 serine/threonine protein phosphatase family protein contains similarity to purple acid phosphatase [Arabidopsis thaliana] gi|20257489|gb|AAM15914 Length = 532 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 244 GHVRHNRRSSR*YPHGLSPCRPEYL 170 GHV RS+R Y + L PC P Y+ Sbjct: 395 GHVHAYERSNRVYNYELDPCGPVYI 419 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +1 Query: 370 IPNASATP-FRTPSPLPPSWRGPESLPRS-TPVPP 468 IP +P FR P P PPS G LP P+PP Sbjct: 146 IPGIPGSPGFRLPFPFPPSGGGIPGLPLPFPPLPP 180 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 PL +P P + P P+P P P P TP P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = +1 Query: 316 VEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 ++ G + P +P P + P PSP P S P P P P Sbjct: 282 IDALGAHFAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 PL +P P + P P+P P P P TP P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAP 329 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = +1 Query: 316 VEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 ++ G + P +P P + P PSP P S P P P P Sbjct: 282 IDALGAHFAPLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAP 331 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 283 PNQIKLVIQRDVEREGLRGSGTP-LAPRSPIPNASATPFRTPSPLPPSWRG 432 P + + +++ V L GT L P P+P A+ P P PP RG Sbjct: 235 PPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPPGARG 285 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 29.1 bits (62), Expect = 1.9 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 S P P PN P TP P PPS S P S PPS QPQ Sbjct: 59 SPPPATAAQPPPNQP--PNTTPPPTPPS-----SPPPSITPPPSPPQPQ 100 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLD 492 P P PN + P PS PPS P S P+ P PP Q P D Sbjct: 70 PNQP-PNTTPPP-TPPSSPPPSITPPPSPPQ--PQPPPQSTPTGD 110 >At5g61090.1 68418.m07665 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; common family members: At4g18570, At3g25690, At4g04980 [Arabidopsis thaliana] Length = 344 Score = 28.7 bits (61), Expect = 2.5 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = +1 Query: 286 NQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 +++KL+ + + G+G ++P P A AT + P +PPS R PE+ PRS P Sbjct: 57 SKVKLLSPEEAMKLTSGGNGVAVSPVKP---ARATS-QVPKRVPPS-RTPEA-PRSVPAC 110 Query: 466 P 468 P Sbjct: 111 P 111 >At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to root nodule extensin [Pisum sativum] gi|15021750|gb|AAK77902; Common family members: At5g19800, At5g57070, At1g72790 [Arabidopsis thaliana] Length = 102 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 5/38 (13%) Frame = +1 Query: 367 PIPNASATPFRTPSPLP-----PSWRGPESLPRSTPVP 465 P+ + S +P+R+P LP P++ P +LP + P+P Sbjct: 38 PLYSPSPSPYRSPVTLPPPPPHPAYSRPVALPPTLPIP 75 >At4g01810.1 68417.m00238 protein transport protein-related related to Sec23 protein [Homo sapiens] gi|1296664|emb|CAA65774 Length = 880 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPF-RTP----SPLPPSWRGPESLPRSTPVPPSQFQPQL 489 G+ TPL P P P TP +P SP+PP + P P PS P L Sbjct: 13 GTLTPLEPNRPSPQPDRTPVPHSPPVVASPIPPRFPQPSFRPDQMS-SPSMKSPSL 67 >At3g57380.1 68416.m06387 expressed protein contains Pfam domain, PF04577: Protein of unknown function (DUF563) Length = 504 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +1 Query: 202 GDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNA 381 GDI++++ DY D + + FK A +K+ + VE + G+ T L R+ + A Sbjct: 235 GDIVSQLSDYPPVDFNGDKRTHCFKEAIVGLKIHDELTVESSLMLGNKTILDFRNVLDQA 294 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P P P+P P +P P PP + P S P +P PP Sbjct: 413 PPPPSPPLP----PPVYSPPPSPPVFSPPPSPPVYSPPPP 448 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 477 P P P++ P+ P PLP P P S P PP + Sbjct: 41 PVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPPAY 80 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 349 PLAPRSPIPNASATPF-RTP--SPLPPSWRGPESLPRSTPVPPSQFQPQL 489 P P P P P + P SP PP+ P +P +P PP+ P L Sbjct: 160 PQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPL 209 >At1g75340.1 68414.m08751 zinc finger (CCCH-type) family protein weak similarity to Nucleoporin NUP42 (Nuclear pore protein NUP42) (Swiss-Prot:P49686) [Saccharomyces cerevisiae]; contains Pfam profile PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 435 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +1 Query: 328 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 GL SG P A S +A TP P+P G ++ P ST P+ F P Sbjct: 295 GLSSSGPPNAFASFNKQPNAFSVNTPQPVPSGPSGFQTNP-STTFKPASFGP 345 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = +1 Query: 331 LRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 L+GS P P P+P A P P P PP R + P P P + P Sbjct: 503 LKGSAPPPPPPPPLPTTIAAP--PPPPPPP--RAAVAPPPPPPPPGTAAAP 549 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +1 Query: 328 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 G GSG P P P+P A+ TP P PP P PP Sbjct: 583 GNSGSGGPPPPPPPMPLANGA---TPPPPPPPMAMANGAAGPPPPPP 626 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 +G P P SP P S P SP PPS PE P S+ PP Sbjct: 143 AGQPPPPESP-PPESLPPPSPESPSPPS---PEPPPPSSLEPP 181 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +1 Query: 322 REGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 R +GT P P S P P P P S S P P PPS +P Sbjct: 131 RRTTAAAGTTTIAGQPPPPESPPPESLPPPSPES----PSPPSPEPPPPSSLEP 180 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 379 ASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 A+ T P PP PESLP +P PS P+ Sbjct: 136 AAGTTTIAGQPPPPESPPPESLPPPSPESPSPPSPE 171 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 +P P+P S+ + SP PPS +S +P PPS PQ Sbjct: 62 SPPPPLPENSSDGSSSSSPPPPSDSSSQS---QSPPPPSTSPPQ 102 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWR--GPESLPRS--TPVPPSQFQP 483 P P+ P +P+P PP W P +P+ P PP F P Sbjct: 30 PHPPVEVEENQPKTSPTPPPPHWMRYPPVLMPQMMYAPPPPMPFSP 75 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 3.2 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +1 Query: 349 PLAPRSPIPNASAT----PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGE 498 P+ SP P+ AT P +T SP PP P +T PP + P GE Sbjct: 91 PVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGE 144 Score = 27.9 bits (59), Expect = 4.3 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 340 SGTPLAPRSPIPN--ASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 S P+ SP P +S P +P P PP P S+P PP Sbjct: 47 SPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 27.1 bits (57), Expect = 7.5 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPL----PPSWRGPESLPRSTPVPPS 471 P P+SP P S++P P P+ PPS P S P T PP+ Sbjct: 42 PSPPQSPPPVVSSSP---PPPVVSSPPPSSSPPPSPPVITSPPPT 83 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P SP + P TPSP PS P ++P PP Sbjct: 135 PKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP 174 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 391 PFRTPSPLPPSWRGPE-SLPRSTPVPPSQFQPQLDGEYRT 507 P+ SP PP + P + +P PP + P L+ Y++ Sbjct: 251 PYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYKS 290 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 507 P + N+ P+ +PSP P S+P PP + P + Y++ Sbjct: 224 PPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKS 273 >At3g16770.1 68416.m02141 AP2 domain-containing protein RAP2.3 (RAP2.3) identical to GI:2281631 [Arabidopsis thaliana]; identical to cDNA EBP GI:2190330 Length = 248 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 409 PLPPSWRGPESLPRSTPVPPSQ 474 P PP++ P S PRST PP++ Sbjct: 140 PPPPNYTPPPSSPRSTDQPPAK 161 >At2g19870.1 68415.m02323 tRNA/rRNA methyltransferase (SpoU) family protein similar to SP|P25270 Ribose methyltransferase PET56 (EC 2.1.1.-) {Saccharomyces cerevisiae}; contains Pfam profile PF00588: SpoU rRNA Methylase (RNA methyltransferase, TrmH) family Length = 589 Score = 28.3 bits (60), Expect = 3.2 Identities = 22/76 (28%), Positives = 33/76 (43%) Frame = +1 Query: 109 GLRLVGGADLATPLIVTRVTPGTPAGRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPN 288 G R+VGG+ + + V PG+P LV G+ + R D + N PN Sbjct: 490 GWRVVGGSVSPKAVALNEVLPGSPT--ILVLGNEGTGLRPLVERSC--TDLVRISGNMPN 545 Query: 289 QIKLVIQRDVEREGLR 336 ++ + D E EG R Sbjct: 546 EVAVTESDDAEGEGFR 561 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPS-----PLPPSWRGPESLPRSTPVPPSQFQPQ 486 P P+ P N+ A P PS P PP P S P P PP + Q Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQ 59 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P+P + P P PP SLP P PP QP Sbjct: 7 PYPPLPQPPSQNSLAPPPPPP------SLPPPVPPPPPSHQP 42 >At1g78310.1 68414.m09126 VQ motif-containing protein contains PF05678: VQ motif Length = 311 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 373 PNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P + F P P PPS +++P S P PP Sbjct: 233 PPSQHNSFPPPHPPPPSSAVSQTVPTSIPAPP 264 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP-SQFQPQLDG 495 + P S P P P P PP ++LPR P PP S +P+ DG Sbjct: 85 IKPLSSPPPPQPPPRSQPPPKPPQ----KNLPRRHPPPPRSPEKPKRDG 129 >At1g03780.1 68414.m00359 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 687 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/70 (20%), Positives = 32/70 (45%) Frame = +3 Query: 303 HTKGRGTRRTERFRHATSATFAHTQRKRHTIQDSKPVASVMAWSGISASQHTGATFAIPA 482 H + R R + F H S F+H ++++ S+ S++ W+ I ++ + + Sbjct: 617 HVEHRAVERAD-FDHKVSILFSHFSKQKNASITSEIDESILFWNQIKEKENQYKRYREES 675 Query: 483 TTGRRIQNLS 512 + + N+S Sbjct: 676 EAAKMVCNIS 685 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPP--SWRGPESLPRSTPVPPSQF 477 P P P P+ + +P PSP PP S P LP P PP + Sbjct: 50 PPPPSPPPPSCTPSP-PPPSPPPPKKSSCPPSPLPPPPPPPPPNY 93 Score = 27.5 bits (58), Expect = 5.7 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPE--SLPRSTPVPP 468 L + P P + P TPSP PPS P+ S P S P+PP Sbjct: 45 LQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPS-PLPP 84 >At5g58770.1 68418.m07361 dehydrodolichyl diphosphate synthase, putative / DEDOL-PP synthase, putative similar to GI:796076 Length = 310 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 135 PRHSTHCHKGDARYSGRQGLSPWGYHR 215 P+H G+ R++ +GL PW HR Sbjct: 78 PKHVAIIMDGNGRWAKNRGLQPWDGHR 104 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 196 VRGDIIAKIDDYDARDLRHEDAQNLFKNAP 285 ++GD K++D + +L + +A LFKN P Sbjct: 3057 LKGDFHLKLNDTEGANLAYSNAITLFKNLP 3086 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +1 Query: 391 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRTY 510 P +P P PPS LP S+ PPS P + Y Sbjct: 32 PIDSPPPSPPSPPPLPKLPFSSTTPPSSSDPNASPFFPLY 71 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 7/56 (12%) Frame = +1 Query: 325 EGLRGSGTPLAPRSPIPNASAT-------PFRTPSPLPPSWRGPESLPRSTPVPPS 471 EG +P +P P P++S P + SP PP+ P+ +P PPS Sbjct: 3 EGQSPENSPPSPTPPSPSSSDNQQQSSPPPSDSSSPSPPAPPPPDDSSNGSPQPPS 58 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQ 486 S +P A SP+P +S+ +P P S PESL S PP QP+ Sbjct: 108 SSSPEAD-SPLPPSSSPEANSPQS-PASSPKPESLADSPSPPPPPPQPE 154 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 346 TPLAPRSPIPNASATPF--RTPSPLPPSWRGPESLPRSTPVPP 468 TP +P P S P+ +PSP P ++ P + S P PP Sbjct: 32 TPYSPLPPYVYNSPPPYVYNSPSPPPYVYKPPPYIYSSPPPPP 74 >At5g52680.1 68418.m06540 heavy-metal-associated domain-containing protein low similarity to pneumococcal surface protein A PspA [Streptococcus pneumoniae] GI:7800654; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 238 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 370 IPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 I NA T R P+P+P R P P+ P PPS Sbjct: 174 INNARKTS-RVPAPVPV--RAPAPTPKPAPAPPS 204 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 358 PRSPI-PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P SP+ P + P + P+ PP + P P +TPV P P Sbjct: 160 PTSPVKPPTTTPPVKPPTTTPPV-QPPTYNPPTTPVKPPTAPP 201 >At5g03150.1 68418.m00263 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 503 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -2 Query: 197 TKSLPAGVPGVTLVTMSGVARSAPPTSRSPQLISRESLRRVTTNV 63 + + P+ G T+ + S A S PP S SP +I ++ L TNV Sbjct: 388 SSTAPSFFAGPTMTSSSATA-SPPPRSSSPMMIQQQ-LNNFNTNV 430 >At5g01040.1 68418.m00007 laccase family protein / diphenol oxidase family protein similar to laccase [Pinus taeda][GI:13661201], lac110 laccase, Populus trichocarpa, EMBL:PTY13773 Length = 584 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +1 Query: 325 EGLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQF 477 +G S +P P P+PN +T R S + GP P V F Sbjct: 304 QGATSSSSPAEPLMPVPNDMSTAHRFTSNITSLVGGPHWTPVPRHVDEKMF 354 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +1 Query: 361 RSPIP---NASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 RSP P N+ P +P P PP P P +P PP + P Sbjct: 516 RSPPPAPVNSPPPPVYSPPPPPPPVHSPPP-PVHSPPPPPVYSP 558 >At4g19570.1 68417.m02877 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 558 Score = 27.5 bits (58), Expect = 5.7 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 1/86 (1%) Frame = +1 Query: 232 DARDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATPFRTPSP 411 +A DL + +Q + + V QR + + S TP S P +S P P P Sbjct: 112 EAWDLLSDKSQRSSYDQKRKSNQVKQRTSGMQKPKRSSTPKPTESDKPASSYGPTPPPEP 171 Query: 412 LPPSWRGPESLPRSTPVP-PSQFQPQ 486 P P P+P P++ +P+ Sbjct: 172 RPKRRPRPNIPEPDIPMPMPTRHKPK 197 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQ 480 S P+ S TP T SP+PP P S S+P+ P Q + Sbjct: 20 SAAPSLSPTPSPTTSPIPP--HKPSS--SSSPLDPKQLK 54 >At3g57180.1 68416.m06366 expressed protein Length = 644 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = +1 Query: 154 VTRVT----PGTPAGRDLVRGDIIAKIDDYDARDLRHEDAQNLFKNAPNQIKLVIQRDVE 321 VTR+T PGT G + G + AK YD L H +L N+ + + I+++V+ Sbjct: 404 VTRLTEAPVPGTTLGILKIGGILSAKAKMYDTPGLLHPYLMSLRLNSEERKMVEIRKEVQ 463 Query: 322 REGLR 336 R Sbjct: 464 PRSYR 468 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 S P P++P+ N S +P P P PS P L P PP+ Sbjct: 55 SEPPPPPKAPV-NVSLSP--PPPPRSPSTSTPPRLGNRNPPPPA 95 >At2g40760.1 68415.m05028 rhodanese-like domain-containing protein contains rhodanese-like domain PF00581 Length = 474 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +1 Query: 274 KNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPI---PNASATPFRTPSPLPPSW 426 + + ++ IQRDV GLR TP++P ++S++P P W Sbjct: 153 RESVEEVLAFIQRDVRLNGLRQVETPVSPEQEAIHHGHSSSSPLAAGEDAPFRW 206 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -2 Query: 206 SPRTKSLPAGVPGVTLVTMSGVARSAPPTSRSPQLISRESLRRVTTNVCNRPIA 45 +P T + AG T ARS+ PTSR P L +++ R +T RPIA Sbjct: 271 TPSTTTKSAGPSRSTTPLSRSTARSSTPTSR-PTLPPSKTISRSSTPT-RRPIA 322 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +1 Query: 196 VRGDIIAKIDDYDARDLRHEDAQNLFKNAP 285 ++GD K++D ++ ++ + +A LFKN P Sbjct: 2984 LKGDFHLKLNDTESANIAYSNAITLFKNLP 3013 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQL 489 SP P+ S+ P P+ P+ P SLP P P SQ P L Sbjct: 246 SPAPSPSSLP-----PISPTSSPPLSLPPQLPPPLSQPPPPL 282 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 373 PNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P++++ PF P P S P S PR P S QP Sbjct: 458 PSSNSKPFPVSQPQPASNPFPVSQPRPNSQPFSMSQP 494 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 367 PIPNASATP-FRTPSPLPPSWRGPESLPRSTPVPPSQFQP 483 P P++ +P FR P P S P P PP +++P Sbjct: 472 PPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEP 511 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 P P SP P + P+ SP PPS P S+P P Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 367 PIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPS 471 P P++ +P +P PPS + S R+TP PPS Sbjct: 442 PPPSSKMSPTFRATPPPPSSKMSPSF-RATPPPPS 475 >At5g18840.1 68418.m02239 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family protein 1 [Arabidopsis thaliana] GI:14585699; contains Pfam profile PF00083: major facilitator superfamily protein Length = 482 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 187 RDLVRGDIIAKIDDYDARDLRHEDAQNLFKN 279 +D+ RG+I+ K++D L HED + +N Sbjct: 7 KDVERGEIVNKVEDLGKPFLTHEDDEKESEN 37 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 27.1 bits (57), Expect = 7.5 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 328 GLRGSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLP---RSTPVPPSQFQPQLDG 495 GL P +P P +A P P P PP P P R P PP P+ G Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQG 310 >At4g13700.1 68417.m02128 serine/threonine protein phosphatase family protein contains Pfam domain PF00149: Ser/Thr protein phosphatase Length = 474 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 244 GHVRHNRRSSR*YPHGLSPCRPEYL 170 GHV R +R Y + L PC P Y+ Sbjct: 412 GHVHAYERMNRIYNYTLDPCGPVYI 436 >At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 387 Score = 27.1 bits (57), Expect = 7.5 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 1/96 (1%) Frame = +3 Query: 123 GRRRPRHSTHCHKGDARYSGRQGLSPWGYHREDRRL*RT*PSTRGRTESIQECSKSD*IS 302 G+ R R ST HKG +G S R DR+ PST +++ + S SD Sbjct: 261 GKHRKRKSTTRHKGRRGERKSKGRSGKKKARPDRK-----PSTNSSSDT-ESSSSSDDGY 314 Query: 303 HTKGRGTRRTERFRHATSATFAHTQRKRHTI-QDSK 407 + R R++ RH + + + RKR I QD K Sbjct: 315 RRRLRDGSRSQSPRHRSR---SQSPRKRQPISQDLK 347 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 391 PFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDGEYRT 507 P+ SP PP + + +P PPS + P EY++ Sbjct: 691 PYVYNSPPPPYYSPSPKVYYKSPPPPSYYSPSPKVEYKS 729 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 459 GS TP P +P P+ TPS PS P + STP Sbjct: 277 GSPTP-TPSTPTPSTPTPSTPTPSTPTPSTPTPSTPAPSTP 316 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 27.1 bits (57), Expect = 7.5 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +1 Query: 238 RDLRHEDAQNLFKNAPNQIKLVIQRDVEREGLRGSGTPLAPRSPIPNASATP--FRTPSP 411 +D R+E ++ ++ P+ V R S +P SP N S TP R+ SP Sbjct: 180 QDRRYEKERSYSRSPPHNGSRVRSGSPGRVKSH-SRSPRRSVSPRKNRSYTPEQARSQSP 238 Query: 412 LPPSWRGPESLPR 450 +P R P +PR Sbjct: 239 VPRQSRSPTPVPR 251 >At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 299 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 AP +P P P TP+P P + + P PVP Sbjct: 116 APVAPAPTRPPPPAPTPTPAPVAATETVTTPIPEPVP 152 >At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 419 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 355 APRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVP 465 AP +P P P TP+P P + + P PVP Sbjct: 116 APVAPAPTRPPPPAPTPTPAPVAATETVTTPIPEPVP 152 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 G +P AP+ P+P + P P P PVPP Sbjct: 37 GKHSPKAPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPP 80 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/53 (32%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSP-LPPSWRGPESLPRSTPVPPSQFQPQLDG 495 SG P+ P PN P P LPP P + + P PP +P G Sbjct: 152 SGLPIPPVVG-PNLPLPPLPIVGPILPPGTTPPATGGKDCPPPPGSVKPPSGG 203 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 G +P AP+ P+P + P P P PVPP Sbjct: 37 GKHSPKAPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPP 80 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/53 (32%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +1 Query: 340 SGTPLAPRSPIPNASATPFRTPSP-LPPSWRGPESLPRSTPVPPSQFQPQLDG 495 SG P+ P PN P P LPP P + + P PP +P G Sbjct: 152 SGLPIPPVVG-PNLPLPPLPIVGPILPPGTTPPATGGKDCPPPPGSVKPPSGG 203 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 358 PRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPP 468 P SP P A +P TP+ PP+ P P S P P Sbjct: 115 PVSP-PPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTP 459 P AP SP P ++ P SP PP+ P P S P Sbjct: 119 PPAPTSPPPTPASPPPAPASP-PPAPASPPPAPVSPP 154 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 27.1 bits (57), Expect = 7.5 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +1 Query: 349 PLAPRS-PIPNASATPFRTPSPLPP--SWR---GPESLPRSTPVPPS 471 PL RS P P A P R P P PP S R P + P P PPS Sbjct: 581 PLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPS 627 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +1 Query: 352 LAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLD 492 ++P P + P P PP GPE PVPPS P D Sbjct: 99 ISPSETPPEVTTVPSDPPPLGPPQTPGPE-----FPVPPSPSPPMPD 140 >At4g09980.1 68417.m01634 methyltransferase MT-A70 family protein low similarity to SP|P25583 Karyogamy protein KAR4 {Saccharomyces cerevisiae}, (N6-adenosine)-methyltransferase [Mus musculus] GI:10179948; contains Pfam profile PF05063: MT-A70 (S-adenosylmethionine-binding subunit of human mRNA:m6A methyl-transferase (MTase)) Length = 775 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +1 Query: 364 SPIPNASATPFRTPSPLPPS--WRGPESLP-RSTPVPP 468 SPIP S TP P P P+ W G + PVPP Sbjct: 451 SPIPGTSVTPVFMP-PFAPTLIWPGARGVDGNMLPVPP 487 >At3g60900.1 68416.m06813 fasciclin-like arabinogalactan-protein (FLA10) Length = 422 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 346 TPLAPRSPIPNASATPFRTPSPLPP-SWRGPESLPRSTP 459 TP +SP P + +P P PP PE P +P Sbjct: 350 TPTPAKSPSPVEAPSPTAASPPAPPVDESSPEGAPSDSP 388 >At3g23030.1 68416.m02903 auxin-responsive protein / indoleacetic acid-induced protein 2 (IAA2) identical to SP|P49678 Auxin-responsive protein IAA2 (Indoleacetic acid-induced protein 2) {Arabidopsis thaliana} Length = 174 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 241 DLR-HEDAQNLFKNAPNQIKLVIQRDVEREGLRGSG 345 DL+ +++ L K N K++I EREG +GSG Sbjct: 94 DLKTYKNYPELLKALENMFKVMIGEYCEREGYKGSG 129 >At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identical to gi|3883122|gb|AAC77824; supported by cDNA gi|3883121|gb|AF082299 Length = 131 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = +1 Query: 349 PLAPRSPIPNASATPFRTPSPLPPSWRGPESLPRSTPVPPSQFQPQLDG 495 P+ P P + +P +P PP P P + P S P DG Sbjct: 53 PVPVNEPTPAPTTSPTTSPVASPPQTDAPAPGPSAGLTPTSSPAPGPDG 101 >At1g12090.1 68414.m01399 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to 14 kDa polypeptide [Catharanthus roseus] GI:407410; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 137 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 337 GSGTPLAPRSPIPNASATPFRTPSPLPPSWRGPE 438 GS TP P P TP TPSP S + P+ Sbjct: 24 GSCTPCGGGCPSPKPKPTPKPTPSPSSGSSKCPK 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,738,174 Number of Sequences: 28952 Number of extensions: 291022 Number of successful extensions: 1955 Number of sequences better than 10.0: 123 Number of HSP's better than 10.0 without gapping: 1195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1810 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -