BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30239 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 25 0.30 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 24 0.70 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 2.8 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 2.8 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 4.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.6 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 25.4 bits (53), Expect = 0.30 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = +1 Query: 283 EEKEKQLTATEAEVAALNRKVQQIEEDLEKSEERSGTAQQKLLEAQQSADENNRMCKVLE 462 +E+EK+L+ EAE K ++ ED +K + + + E + + E+ + K ++ Sbjct: 217 KEREKELSDDEAE----EEKKEEEGEDKDKDKPKIEDVGED--EDEDTKKEDKKKKKTIK 270 Query: 463 NRAQQDEE 486 + +DEE Sbjct: 271 EKYTEDEE 278 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 24.2 bits (50), Expect = 0.70 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 331 LNRKVQQIEEDLEKSEERSGTAQQKLLEAQQSADENNRMCKVLEN 465 LNR+V QI++D+E + S + + + DE R + EN Sbjct: 294 LNREVDQIKQDVEDLKRWSDRIYAAIHQGSVT-DERGRSITLTEN 337 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 268 PAPACSCSGSGLPPPGRASSGVRGLPRLP 182 P P+ G LPP G + LP++P Sbjct: 153 PNPSIIDPGPALPPAGFLCNNYLPLPQVP 181 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 2.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 268 PAPACSCSGSGLPPPGRASSGVRGLPRLP 182 P P+ G LPP G + LP++P Sbjct: 153 PNPSIIDPGPALPPTGFLCNNYPPLPQVP 181 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.4 bits (43), Expect = 4.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 256 CSCSGSGLPPPGRASSGVRGLPRLPSQHG 170 C G P PG S V G P + S HG Sbjct: 131 CLSGGPKHPDPG--SLQVPGAPMMMSSHG 157 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 187 NEEVRELQKKLAQVEED 237 N+E+R ++K +VEED Sbjct: 98 NQEIRGPKRKTWKVEED 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.304 0.121 0.306 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,263 Number of Sequences: 336 Number of extensions: 1807 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.1 bits)
- SilkBase 1999-2023 -