BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30238 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 24 3.5 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 23 4.6 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 8.1 EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. 23 8.1 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = +2 Query: 14 LVIILPVLDSFVKMAQVLKKLTTQVLK 94 + +I+P + K+ Q++ KLT++V+K Sbjct: 301 MYVIMPNNSNRAKLQQLIPKLTSEVVK 327 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 433 LYCTDTVRHWRSPPWTRVHNETLR 504 +Y D + RSPP R+ N T+R Sbjct: 42 MYLRDWRKALRSPPSYRIGNRTIR 65 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 22.6 bits (46), Expect = 8.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 441 TVQLLLFLMTGLSSPKASLATASVYVASPLMGAY 340 T ++ L+T L + S+ SVYV PL+ Y Sbjct: 562 TQEIFSALITLLFIFETSIKLVSVYVRHPLLSEY 595 >EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 323 RGLNHEYAPISGEATYTD 376 R L HEY I+GE Y D Sbjct: 31 RHLFHEYEHITGEFDYPD 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,006 Number of Sequences: 2352 Number of extensions: 12507 Number of successful extensions: 32 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -