BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30235 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) 132 2e-31 SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 4e-24 SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) 89 2e-18 SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) 65 4e-11 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 46 1e-05 SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) 46 1e-05 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) 42 3e-04 SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 40 0.001 SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) 40 0.001 SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 35 0.046 SB_17979| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_9442| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_16528| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) 33 0.14 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 33 0.14 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 33 0.18 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) 32 0.24 SB_50313| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_27554| Best HMM Match : cNMP_binding (HMM E-Value=2.6) 31 0.43 SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 31 0.43 SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_10829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) 31 0.74 SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) 31 0.74 SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_11281| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 29 3.0 SB_52670| Best HMM Match : FxsA (HMM E-Value=2.5) 29 3.0 SB_5902| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_29710| Best HMM Match : LHC (HMM E-Value=3.3) 28 4.0 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_35440| Best HMM Match : p450 (HMM E-Value=2.2e-35) 28 4.0 SB_19362| Best HMM Match : M (HMM E-Value=0.0014) 28 4.0 SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) 28 5.3 SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) 27 6.9 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 27 9.2 SB_18513| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 27 9.2 SB_43766| Best HMM Match : RVT_1 (HMM E-Value=0.43) 27 9.2 SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_36054| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_35537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) 27 9.2 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_7359| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_19865| Best HMM Match : cNMP_binding (HMM E-Value=8.3e-39) Length = 373 Score = 132 bits (319), Expect = 2e-31 Identities = 67/164 (40%), Positives = 103/164 (62%), Gaps = 1/164 (0%) Frame = +2 Query: 26 PVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQM 205 P+ + +RR +V AE Y+P E+ +D A PKS+ QR L + + + LF + + Sbjct: 75 PIIKGRSRRAAVSAEPYNPNEN-ADFKAK-FHPKSEEQRNHLKKKLLELWLFEKFHREDL 132 Query: 206 QQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKV-VHTYEGSGSF 382 +LD+MFEK+ P E +I+ GD+GDNFYVI G +DV + + VHT+ G+G F Sbjct: 133 DVILDSMFEKKVSPEEIIIKVGDEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMF 192 Query: 383 GELALMYNMPRAASVRAQTAGALWAMDRHTFRRILLKSAFKKRK 514 GELALM+N R A++ A+T G LWA+DR TF ++++ A ++R+ Sbjct: 193 GELALMHNSLRNATIVAKTEGTLWALDRSTFVQVVVGGAQRRRE 236 Score = 62.5 bits (145), Expect = 2e-10 Identities = 40/118 (33%), Positives = 62/118 (52%), Gaps = 1/118 (0%) Frame = +2 Query: 137 QRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDN-FYVIENGVF 313 +R R E ++ + + + L ++ +V DA++ K + GE VIR+G++ Y IE G Sbjct: 234 RRERNIELLKSVSILKELKPDELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKV 293 Query: 314 DVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAASVRAQTAGALWAMDRHTFRRIL 487 V V D VEK V FGELAL+ N PR+ASV A ++ + F R++ Sbjct: 294 RVTVK-DGEVEKTVEF--DKNYFGELALVMNQPRSASVYAVGECKFASLKKDDFERLM 348 >SB_58379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 107 bits (258), Expect = 4e-24 Identities = 47/94 (50%), Positives = 72/94 (76%) Frame = +2 Query: 20 KPPVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQ 199 +PP R+ RR+SV AE + P+ +D + P V+PK+D QR RL +A++ ILLF++L + Sbjct: 92 EPPKNRYA-RRQSVCAEPFHPDSEDEGDEQPIVYPKTDEQRQRLNDAIKNILLFKNLAKE 150 Query: 200 QMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIE 301 Q+ +VLDAMFE++++ G+++I QGDDGDNFYVI+ Sbjct: 151 QLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVID 184 >SB_12691| Best HMM Match : cNMP_binding (HMM E-Value=1.7e-26) Length = 376 Score = 89.4 bits (212), Expect = 2e-18 Identities = 47/129 (36%), Positives = 78/129 (60%), Gaps = 1/129 (0%) Frame = +2 Query: 125 KSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 304 K + + + EA+ ++L+A Q+++V++ M E+ + EY+I++ + G + YV+E Sbjct: 136 KINPSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEE 195 Query: 305 GVFDVLVTGDDRVEKVVHTYEGSG-SFGELALMYNMPRAASVRAQTAGALWAMDRHTFRR 481 G V G V + G G +FGELA++YN R ASVRAQT+G LWA+DR TF+ Sbjct: 196 GKCQVTKEG------TVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQT 249 Query: 482 ILLKSAFKK 508 I++K+ + Sbjct: 250 IMMKTGLMR 258 Score = 44.4 bits (100), Expect = 6e-05 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 155 EAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENG-VFDVLVTG 331 E +R + L + L + ++ D + E E GEY+IRQG GD F++I++G ++V G Sbjct: 264 EFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNGLCLVVDG 323 Query: 332 DD 337 +D Sbjct: 324 ED 325 >SB_52453| Best HMM Match : cNMP_binding (HMM E-Value=1.9e-26) Length = 370 Score = 64.9 bits (151), Expect = 4e-11 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +2 Query: 350 VVHTYEGSGSFGELALMYNMPRAASVRAQTAGALWAMDRHTFRRILLKSAFKKRK 514 +V T GSFGELAL+Y PRAA+++A+T LWA+DR T+RRIL+ S +KR+ Sbjct: 179 LVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRKRR 233 Score = 61.3 bits (142), Expect = 5e-10 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 4/124 (3%) Frame = +2 Query: 128 SDAQRARLAEA-VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIEN 304 S ++ R+ E + + + SLD + V DA+ + + G+ V+ QG+ GD F++I Sbjct: 227 SQIRKRRMYEQFLEKVSILESLDKWERLTVADALEPTQFQDGDDVVVQGEHGDEFFIIVE 286 Query: 305 GVFDVLV---TGDDRVEKVVHTYEGSGSFGELALMYNMPRAASVRAQTAGALWAMDRHTF 475 G VL +D +E V S FGE+AL+ N PRAA+V+A+ +DR F Sbjct: 287 GTAVVLQRRSANEDFIE--VSRLGPSDYFGEIALVLNRPRAATVQARGTLKCVKLDRQRF 344 Query: 476 RRIL 487 R+L Sbjct: 345 ERVL 348 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 58.0 bits (134), Expect = 4e-09 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 1/128 (0%) Frame = +2 Query: 47 RRKSVFAETYDPEEDDSDEGAPAV-FPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDA 223 +R++V E+ +++S G FPK + + +A+ ++L+A Q+++++D Sbjct: 442 KRQAVSGESSTKAQEESRTGKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVRKIVDC 501 Query: 224 MFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMY 403 M+ + + +I++GD G+ Y I +G V R KV+ FGELA++Y Sbjct: 502 MYSNTFQRNDVIIQEGDAGNALYAIADGRLQVT-----RENKVLGEMVAGMVFGELAILY 556 Query: 404 NMPRAASV 427 N R A+V Sbjct: 557 NCRRTATV 564 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 46.4 bits (105), Expect = 1e-05 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Frame = +2 Query: 248 GEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGS-FGELALM-YNMPRAA 421 G+Y+ R G GD Y I+ G+ D+L E + T G GS FGE+ L+ R A Sbjct: 648 GDYICRSGHRGDKMYFIQKGIVDILTR-----EGALATSLGDGSHFGEICLLTKEARRVA 702 Query: 422 SVRAQTAGALWAMDRHTFRRIL 487 SVRA T ++++ F +L Sbjct: 703 SVRAATTCDVYSLSATHFHEVL 724 >SB_56249| Best HMM Match : cNMP_binding (HMM E-Value=5.4e-23) Length = 279 Score = 46.4 bits (105), Expect = 1e-05 Identities = 26/90 (28%), Positives = 44/90 (48%) Frame = +2 Query: 242 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAA 421 +PG+Y++ GD G Y I G ++L + V+ T FGE+ L+Y R A Sbjct: 148 KPGDYIVYAGDMGREMYCIRRGQVNILCE-----DNVIGTLGPGSFFGEIGLIYGESRFA 202 Query: 422 SVRAQTAGALWAMDRHTFRRILLKSAFKKR 511 +V+A+T + + +H +L + KR Sbjct: 203 TVQAKTYCQILMLTKHDLDEVLEEFPIIKR 232 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 44.0 bits (99), Expect = 7e-05 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +2 Query: 47 RRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAM 226 RR SV E Y+P + A +PKS+ R RL + I +F+S Q+ +LDAM Sbjct: 291 RRDSVAGEVYEPVNSNC-VSAQRFYPKSEDARKRLENVIGNIFIFKSCGKDQINMMLDAM 349 Query: 227 FEK 235 + K Sbjct: 350 YIK 352 >SB_16296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1152 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 5/86 (5%) Frame = +2 Query: 245 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMP---- 412 PG+++ RQG+ G Y++ G +VL D E V+ T FGE++L+ NM Sbjct: 547 PGDFICRQGEKGREMYIVNKGSLEVL----DEKETVLATLSAGSHFGEISLL-NMKGIGN 601 Query: 413 -RAASVRAQTAGALWAMDRHTFRRIL 487 R ASVR+ L+ + + +L Sbjct: 602 LRTASVRSVGFSDLFQLSKTDLEEVL 627 >SB_43598| Best HMM Match : cNMP_binding (HMM E-Value=4.3e-22) Length = 581 Score = 41.9 bits (94), Expect = 3e-04 Identities = 21/80 (26%), Positives = 44/80 (55%) Frame = +2 Query: 161 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 340 +R + +F + +++++ + + PG+Y+ R+GD G Y++ +G V+ GDD Sbjct: 449 LRQVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVV--GDDG 506 Query: 341 VEKVVHTYEGSGSFGELALM 400 + EGS FGE++++ Sbjct: 507 TTVLAILSEGS-YFGEISIL 525 >SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 41.5 bits (93), Expect = 4e-04 Identities = 25/115 (21%), Positives = 57/115 (49%), Gaps = 4/115 (3%) Frame = +2 Query: 155 EAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGD 334 +++R + +F+ +A + +++ + + PG+YV R+G+ G Y++ G +V+ Sbjct: 373 DSLRKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVV---S 429 Query: 335 DRVEKVVHTYEGSGSFGELALM----YNMPRAASVRAQTAGALWAMDRHTFRRIL 487 + K+ E FGE++++ R ASVR+ L+ + ++ +L Sbjct: 430 EHGTKIYAVLEAGSYFGEISVLSMSSAGNRRTASVRSVGYTELFCLAKNDLMEVL 484 >SB_33011| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +2 Query: 161 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 340 ++ + +F+ D + +++ + + PG+Y+ R G+ G Y+I +G +V+V Sbjct: 122 LKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTT 181 Query: 341 VEKVVHTYEGSGS-FGELALM 400 EK+V G+ FGE++L+ Sbjct: 182 GEKIVVASLTEGNYFGEISLL 202 >SB_18428| Best HMM Match : cNMP_binding (HMM E-Value=0.037) Length = 210 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +2 Query: 161 VRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDR 340 ++ + +F+ D + +++ + + PG+Y+ R G+ G Y+I +G +V+V Sbjct: 122 LKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTT 181 Query: 341 VEKVVHTYEGSGS-FGELALM 400 EK+V G+ FGE++L+ Sbjct: 182 GEKIVVASLTEGNYFGEISLL 202 >SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 37.5 bits (83), Expect = 0.006 Identities = 22/80 (27%), Positives = 42/80 (52%) Frame = +2 Query: 251 EYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAASVR 430 +Y++ +GD G +I+ G +V +TG+D +V+ E +G+ L+ P ++R Sbjct: 816 DYILHKGDIGQQLIIIKRGTAEV-ITGED--PEVILPLEEMSFYGDRYLLAPGPHLETLR 872 Query: 431 AQTAGALWAMDRHTFRRILL 490 A T ++ ++R ILL Sbjct: 873 AVTNVDVFILERSDLDEILL 892 >SB_11282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 36.7 bits (81), Expect = 0.011 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 14/95 (14%) Frame = +2 Query: 242 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRV--------------EKVVHTYEGSGS 379 E +I+QG G +FY I +G V +DR K++ G S Sbjct: 185 EQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQSMIIAYFSKIISEMTGGDS 244 Query: 380 FGELALMYNMPRAASVRAQTAGALWAMDRHTFRRI 484 FGELALM+++ R A++ + +D+ F + Sbjct: 245 FGELALMHDIRRTATIICKERSEFLRVDKDDFNEM 279 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 34.7 bits (76), Expect = 0.046 Identities = 22/101 (21%), Positives = 42/101 (41%) Frame = +2 Query: 176 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVV 355 LF+ L+ + ++ + R ++RQG+ G+ FY+I G V D E Sbjct: 784 LFKLLEDDALLDIIKNVTLTRYRKDNIIMRQGEKGNCFYIILKGSVSVYAKQDGDGEAAT 843 Query: 356 HTYEGSGSFGELALMYNMPRAASVRAQTAGALWAMDRHTFR 478 H + S E L++ ++ ++ G + +D R Sbjct: 844 HHEQSVRSHKERLLLFGAELSSLRAGRSFGEMVMVDERKER 884 >SB_17979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 34.7 bits (76), Expect = 0.046 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 1/81 (1%) Frame = +2 Query: 248 GEYVIRQGDDGDNFYVIENGVFDVLVTGD-DRVEKVVHTYEGSGSFGELALMYNMPRAAS 424 GEY+IR+GD G +++ G ++ + D +++E++V + + + L+ P S Sbjct: 212 GEYIIRKGDIGQQLIILKRGTAAIVKSEDPEKLEEMV----VNSFYSQRYLLLTGPYLES 267 Query: 425 VRAQTAGALWAMDRHTFRRIL 487 VRA T ++ +D+ +L Sbjct: 268 VRAITNVDVFLLDKKDLYEVL 288 >SB_9442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 34.7 bits (76), Expect = 0.046 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 4/69 (5%) Frame = -3 Query: 349 LFDAVVSGDQDVENAVLDDVEVVAVIALSD-YVLAGLGSLFEHRIQNLL---HLLRVKRT 182 +F AVVS +NA L D + V+ +D Y+L GL L EH+I LL ++L V RT Sbjct: 40 VFAAVVSFVYR-DNAELTDEILYNVLCAADIYLLHGLKRLCEHKISGLLDRANVLTVLRT 98 Query: 181 EQQYAPDRL 155 + ++ DRL Sbjct: 99 ARLFSLDRL 107 >SB_3363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 34.7 bits (76), Expect = 0.046 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 4/69 (5%) Frame = -3 Query: 349 LFDAVVSGDQDVENAVLDDVEVVAVIALSD-YVLAGLGSLFEHRIQNLL---HLLRVKRT 182 +F AVVS +NA L D + V+ +D Y+L GL L EH+I LL ++L V RT Sbjct: 262 VFAAVVSFVYR-DNAELTDEILYNVLCAADIYLLHGLKRLCEHKISGLLDRANVLTVLRT 320 Query: 181 EQQYAPDRL 155 + ++ DRL Sbjct: 321 ARLFSLDRL 329 >SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 18 KSRQWRALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSLRRS 164 KS + RA ++ ++P+ +TPK ++ ++ L PSR P S +R+ Sbjct: 603 KSARTRAWSVSPRLYTPKSITPKFILSPRQTLSAPPSRPKTAPTSAQRT 651 >SB_16528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 233 KRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTG 331 +R PG+Y+I+QGD+ Y I G +VL G Sbjct: 81 RRHLPGQYLIKQGDEVKKLYFIAKGFVEVLKDG 113 >SB_48433| Best HMM Match : Ion_trans (HMM E-Value=6.1e-26) Length = 1344 Score = 33.1 bits (72), Expect = 0.14 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 5/79 (6%) Frame = +2 Query: 245 PGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSG-SFGE-LALMYNMPRA 418 PG+++I QGD+ + Y + G +VL DD + ++ G G SFGE L N P Sbjct: 1004 PGDFIIYQGDEISHLYFLVRGTVEVL--KDDTIMAIL----GKGDSFGENFGLSPNRPPG 1057 Query: 419 ---ASVRAQTAGALWAMDR 466 S+RA T L A+ R Sbjct: 1058 NSHVSIRALTYCDLRAISR 1076 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -2 Query: 455 PTERRRSGPVQMPPAACCTSGPVRQTNRNLRMCGPP 348 PT SGP++ PAA SGP + RN+R P Sbjct: 1066 PTHTPNSGPLEENPAASSPSGPPAKQRRNVRFVANP 1101 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 32.7 bits (71), Expect = 0.18 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 4/80 (5%) Frame = +2 Query: 110 PAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNF 289 PA F + Q + A A+ G+ + R ++ + M +K E V G G F Sbjct: 845 PAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEGEKNILVFDLG--GGTF 902 Query: 290 YV----IENGVFDVLVTGDD 337 V I+NGVF+V+ T D Sbjct: 903 DVSLLTIDNGVFEVVATNGD 922 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 32.3 bits (70), Expect = 0.24 Identities = 27/97 (27%), Positives = 38/97 (39%), Gaps = 1/97 (1%) Frame = -1 Query: 390 SSPNEPEPSYVWTTFSTRSSPVT-RTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASR 214 S+P+ P T ST S+P T T TP + +PS+PC + +P + + S Sbjct: 19 STPSTPSTPSTPRTPSTPSTPCTPSTPSTPSTPITPSTPSTPCTHS-TPSAPSTPSTPST 77 Query: 213 TCCICCASRERNSSMPRTASARRALCASDLGNTAGAP 103 C S S P T S A +T P Sbjct: 78 PCTPSTPSTPSTPSTPSTPSTPSAPSTPSTPSTPSTP 114 Score = 29.9 bits (64), Expect = 1.3 Identities = 27/96 (28%), Positives = 37/96 (38%) Frame = -1 Query: 390 SSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRT 211 S PN P +T ST S+P+ T TP + + +PS P +P + + S Sbjct: 220 SMPNTPSTPSTPSTPSTLSTPI--TPSTPSTPSTPSTPSMPS----TPSTPSTPSTPSTP 273 Query: 210 CCICCASRERNSSMPRTASARRALCASDLGNTAGAP 103 C S SMP T S +T AP Sbjct: 274 CTPNTPSTPSTPSMPSTPSTPSTPSTPSTPSTPSAP 309 Score = 29.9 bits (64), Expect = 1.3 Identities = 27/96 (28%), Positives = 37/96 (38%) Frame = -1 Query: 390 SSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSDLFSNIASRT 211 S PN P +T ST S+P+ T TP + + +PS P +P + + S Sbjct: 770 SMPNTPSTPSTPSTPSTLSTPI--TPSTPSTPSTPSTPSMPS----TPSTPSTPSTPSTP 823 Query: 210 CCICCASRERNSSMPRTASARRALCASDLGNTAGAP 103 C S SMP T S +T AP Sbjct: 824 CTPNTPSTPSTPSMPSTPSTPSTPSTPSTPSTPSAP 859 >SB_33629| Best HMM Match : Extensin_2 (HMM E-Value=2.2) Length = 958 Score = 32.3 bits (70), Expect = 0.24 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 1/84 (1%) Frame = +2 Query: 35 RFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSDAQRARLAEAVRGI-LLFRSLDAQQMQQ 211 ++NN + + +P+ D+ V PK D Q R EAV + L + D Q Q Sbjct: 272 QYNNADGPIQDQYNNPDGPIQDQNESHVGPKQDQQEERSTEAVGDLPALIANTDQWQAQG 331 Query: 212 VLDAMFEKRSEPGEYVIRQGDDGD 283 +A P E V + +D D Sbjct: 332 DDEATQNHDDNPNERVTEKPEDAD 355 >SB_50313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 31.5 bits (68), Expect = 0.43 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 245 PGEYVIRQGDDGDNFYVIENGVFDVLVTG 331 PG Y+I++GD+ Y + G DV+ +G Sbjct: 50 PGHYIIKEGDEVKYLYFVVEGTVDVIKSG 78 >SB_27554| Best HMM Match : cNMP_binding (HMM E-Value=2.6) Length = 82 Score = 31.5 bits (68), Expect = 0.43 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +2 Query: 374 GSFGELALMYNMPRAASVRAQTAGALWAMDRHTFRRIL 487 G FGELAL+ + RAASV + ++D H F R+L Sbjct: 16 GYFGELALITHNTRAASVYSVGDCVCASLDVHAFERLL 53 >SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) Length = 816 Score = 31.5 bits (68), Expect = 0.43 Identities = 12/52 (23%), Positives = 29/52 (55%) Frame = +2 Query: 176 LFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTG 331 LF ++ ++ + M + PG +++ +GD+ D ++I+ G +++V G Sbjct: 480 LFMDSESSCLRGISMRMRRQYHLPGHFIMYEGDEVDTLHLIKRGKIEIIVNG 531 >SB_21541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 36 ALTIGANPFSPRLMTPKRMILTKEPLPCSPSRTHREPVSL 155 ALT + PFSP + P + LT P SP++ P SL Sbjct: 61 ALTAYSRPFSPDSLFPPPLALTAYSRPFSPAKLIARPFSL 100 >SB_10829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 407 MPRAASVRAQTAGALWAMDRHTFRRILLKSAFKK 508 M R A++R + AG +D H F+RIL +FKK Sbjct: 66 MIREAALRTKGAGGPSNVDAHGFQRILASKSFKK 99 >SB_24078| Best HMM Match : cNMP_binding (HMM E-Value=1.4e-26) Length = 692 Score = 30.7 bits (66), Expect = 0.74 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +2 Query: 248 GEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSG-SFGELALMYNMPRAAS 424 G V R+GD G YV+ +G + G V + + G +FGE + + + Sbjct: 402 GSAVYREGDPGHEMYVLVHGRVGLFAEGHQLA--VFDSGDKRGFTFGEEGFFTDKEKRCT 459 Query: 425 VRAQTAGALWAMDRHTFRRIL 487 ++A T + + +H F IL Sbjct: 460 IKALTPCQIITLKKHHFYDIL 480 >SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) Length = 644 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 407 MPRAASVRAQTAGALWAMDRHTFRRILLKSAFKK 508 M R A++R + AG +D H F+RIL +FKK Sbjct: 365 MIREAALRTKGAGGPSNVDAHGFQRILASKSFKK 398 >SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 407 MPRAASVRAQTAGALWAMDRHTFRRILLKSAFKK 508 M R A++R + AG +D H F+RIL +FKK Sbjct: 384 MIREAALRTKGAGGPSNVDAHGFQRILASKSFKK 417 >SB_11281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = +2 Query: 377 SFGELALMYNMPRAASVRAQTAGALWAMDRHTFRRILLKSAFKK 508 SFGELAL++++ R A++ + +D+ F + LK+++K+ Sbjct: 223 SFGELALLHDIKRTATIICKGRAEFLRLDKPGFDEV-LKNSYKR 265 >SB_44854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 406 VVHQGQFAKRTGTFVCVDHLFDAVV 332 +VH G RTGTF+ +D L D +V Sbjct: 489 LVHCGAGVGRTGTFIAIDSLMDQMV 513 >SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 998 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 75 MTPKRMILTKEPLPCSPSRTHRE 143 MTP R LT LPC SRT+ E Sbjct: 941 MTPSRASLTPTHLPCRDSRTNSE 963 >SB_52670| Best HMM Match : FxsA (HMM E-Value=2.5) Length = 112 Score = 28.7 bits (61), Expect = 3.0 Identities = 29/109 (26%), Positives = 48/109 (44%), Gaps = 2/109 (1%) Frame = -3 Query: 349 LFDAVVSGDQDVENAVLDDVEVVAVIAL-SDYVLAGLGSLFEHRIQNLLHLLRVKRTEQQ 173 +F V++ + +L + VA++ L S Y A + + ++ N L R + E++ Sbjct: 4 IFTIVINVYASIALQILIAIGAVALVTLTSSYATAFINVKKQRQLHNQSDLQRTIQKERE 63 Query: 172 YAPDRLSET-GSLCVRLGEHGRGSFVRIILFGVISLGENGFAPIVKARH 29 A L T SL L G G F V +N F P+V++RH Sbjct: 64 LAKTLLLVTITSLLTWLPLIGAGMGPMFPSFDVF---DNQFEPVVQSRH 109 >SB_5902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 225 IASRTCCICCASRERNSS 172 IAS CC CC R R+SS Sbjct: 402 IASCICCCCCCCRRRSSS 419 >SB_47007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 382 KRTGTFVCVDHLFDAVVSGDQDVENAVLDDVE 287 K + FVCVDH + V DV A+L VE Sbjct: 105 KHSSQFVCVDHDAEYVPGSGADVNGALLYPVE 136 >SB_29710| Best HMM Match : LHC (HMM E-Value=3.3) Length = 343 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 301 LDDVEVVAVIALSDYVLAGLGSLFEHRI 218 ++ V++ VIAL D V+AG +L HR+ Sbjct: 311 MEQVQLAGVIALLDVVVAGSTALIAHRL 338 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = -1 Query: 393 ASSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLITYSPGSD 238 A S N P P TT SS T +S S T SPSS + +PG D Sbjct: 962 APSLNNPNPRSSCTT--PPSSDTTNSSSAGPSATNNASPSSSPYVASAPGKD 1011 >SB_57887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 301 LDDVEVVAVIALSDYVLAGLGSLFEHRI 218 ++ V++ VIAL D V+AG +L HR+ Sbjct: 498 MEQVQLAGVIALLDVVVAGSTALIAHRL 525 >SB_35440| Best HMM Match : p450 (HMM E-Value=2.2e-35) Length = 806 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +3 Query: 321 WSPETTASKRWSTHTKVPVRLANWP*CTTCRG-RHLYGPRPPALCGPWTA 467 +SP +S R TH P A WP C T R + P P PW A Sbjct: 53 YSPVQPSSVRSITHPYNPRGTAPWPACITHPSVRSITHPYNPRGTAPWPA 102 >SB_19362| Best HMM Match : M (HMM E-Value=0.0014) Length = 722 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 269 GDDGDNFYVIENGVFDV---LVTGDDRVEKVVHTYEGS 373 G DG+ + IENG DV L+ ++R+ +++ YEG+ Sbjct: 204 GRDGNKYMGIENGKADVSEKLLQENERLRELLRQYEGN 241 >SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1392 Score = 28.3 bits (60), Expect = 4.0 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +2 Query: 167 GILLFRSLDA-QQMQQVLDAMFEKRSEPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRV 343 G L+ +LD+ Q+ +V D F E + GD +++EN L +GD + Sbjct: 37 GSLVENALDSGDQLIEVRDMTFIGTGSLVENALDSGDQLIEAHLVENA----LDSGDQLI 92 Query: 344 EKVVHTYEGSGSFGELAL 397 E T+ G+GS E AL Sbjct: 93 EVRDMTFIGTGSLVEYAL 110 >SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) Length = 405 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 26 PVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSD 133 P + S AE P E DS+EG P + P D Sbjct: 276 PAEPVEQSQDSGVAEAESPAEQDSEEGTPGMSPPVD 311 >SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) Length = 423 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = -3 Query: 199 LRVKRTEQQYAPDRLSETGSLCVRLGEHGRGSFVRIILFG--VISLGENGFAPIVKARHW 26 +R+ R + Y RL G + +RL HG+ ++R+ G I L +G I RH Sbjct: 266 IRLNRHGKMYI--RLDRNGKMYIRLNRHGK-MYIRLNRHGKMYIRLNRHGKMYIRLNRHG 322 Query: 25 RLFYKI 8 +++ ++ Sbjct: 323 KMYIRL 328 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = -1 Query: 288 KLSPSSPCLITYSPGSDLFSNIASRTCCICCASRERNSSMPRTASARRALCASDLGNTAG 109 K +P+SP L S G D + + CI S R A+ + A C + NT G Sbjct: 311 KSAPTSPDLTLASAGKDTRKRLNYHSQCIDVDECTEMSPRCRCANQKSASCNATCINTLG 370 Query: 108 A 106 + Sbjct: 371 S 371 >SB_18513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4634 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/57 (26%), Positives = 23/57 (40%) Frame = +2 Query: 242 EPGEYVIRQGDDGDNFYVIENGVFDVLVTGDDRVEKVVHTYEGSGSFGELALMYNMP 412 +P + IR+G DGD V+ D T K V + GE + ++P Sbjct: 172 QPANFTIRRGGDGDTEIVVTYSTVDGTATASSADYKAVAFGRVTMGVGEFSKEISIP 228 >SB_49169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 29 VARFNNRRKSVFAETYDPEEDDSDEGAPAVFP--KSDAQRARLAEAV 163 V R K A+ D E D +EGAPA P K RA L E + Sbjct: 114 VDRVKKMHKKKMAKKEDEEMDVPEEGAPAKKPAVKKLGSRAALRECI 160 >SB_47365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +3 Query: 90 MILTKEPLPCSPSRTHREPVSLRRSGAYCCSVLLTRSKCSRFWMRCSKRDPS 245 MI E P P P++ + T S+FWM+CS R+ S Sbjct: 442 MIAEDEARPVLPDAPRYPPIN--SGDKIALKMSYTSGDLSKFWMKCSDRECS 491 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 27.1 bits (57), Expect = 9.2 Identities = 30/132 (22%), Positives = 50/132 (37%), Gaps = 2/132 (1%) Frame = +2 Query: 101 EGAPAVFPKSDAQRARLAEAVRGILLFRSLDAQQMQQVLDAMFEKRSEPGEYVIRQGDDG 280 E A S + GI + S+ + +++ +F+K +EP E IR Sbjct: 268 ERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIP 327 Query: 281 DNFYVIENGVFD-VLVTGDDRVEKVVHTYEGSGSFGELALMYNMPRAASVRAQTAGALWA 457 + + D VLV G R+ K+ + EL N A + A A+ Sbjct: 328 GG----KESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILH 383 Query: 458 MDR-HTFRRILL 490 D+ T + +LL Sbjct: 384 GDKDDTVKDLLL 395 >SB_43766| Best HMM Match : RVT_1 (HMM E-Value=0.43) Length = 491 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 407 MPRAASVRAQTAGALWAMDRHTFRRILLKSAFKK 508 M R A++R + +G +D + FRRIL +FK+ Sbjct: 1 MVRQAALRTKGSGGPCGVDANGFRRILACKSFKQ 34 >SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 17 KKPPVARFNNRRKSVFAETYDPEEDDSDEGAPAVFPKSD 133 +K PV+ + S E +PE+ D+ E PA P S+ Sbjct: 492 RKSPVSEAEAPKPSAAKEEAEPEQMDTSEPEPAKEPSSE 530 >SB_36054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 27.1 bits (57), Expect = 9.2 Identities = 34/100 (34%), Positives = 42/100 (42%), Gaps = 5/100 (5%) Frame = -1 Query: 393 ASSPNEPEPSYVWTTFSTRSSP-VTRTSKTPFS-MT*KLSPSSPCLIT---YSPGSDLFS 229 A SPN P V S +SSP +TR P S T K+ S T SPG S Sbjct: 88 APSPNCP----VSMKTSGQSSPRLTRHLARPMSPSTTKIFARSSVPFTGHHVSPGGGTDS 143 Query: 228 NIASRTCCICCASRERNSSMPRTASARRALCASDLGNTAG 109 TCC C + S+ ++ A RALC + L G Sbjct: 144 RC---TCCCCTEDLLKIQSLLSSSFADRALCETMLTEMNG 180 >SB_35537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/61 (24%), Positives = 24/61 (39%) Frame = -1 Query: 438 VWARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPFSMT*KLSPSSPCLI 259 VW + +SSP VWT S+ + + T F K P++P ++ Sbjct: 86 VWISAQVDVMGFHAESSSPTGTVMLIVWTILPQLSTSIVHCATTAFPRFNKEMPTNPLIL 145 Query: 258 T 256 T Sbjct: 146 T 146 >SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) Length = 1737 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 367 FVCVDHLFDAVVSGDQDVENAVLDDVE 287 F+ +DH D+V S D ENAV ++E Sbjct: 1115 FINLDHESDSVKSSVADAENAVPSEIE 1141 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +3 Query: 90 MILTKEPLPCSPSRTHREPVSLRRSGAYCCSVLLTRSKCSRFWMRCSKRDPS 245 MI E P P P++ + T S+FWM+CS R+ S Sbjct: 32 MIAEDEARPVLPDAPRYPPIN--SGDKIALKMSYTSGDLSKFWMKCSDRECS 81 >SB_7359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 432 ARTDAARGMLYIRASSPNEPEPSYVWTTFSTRSSPVTRTSKTPF 301 +R +A L I+ SSP + S V +T++T + VT T PF Sbjct: 98 SRGNATIDWLAIQGSSPTMQQGSVVLSTWTTGTQCVTVTLPKPF 141 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,179,642 Number of Sequences: 59808 Number of extensions: 390361 Number of successful extensions: 1629 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 1448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1601 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -