BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30234 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82287-2|CAB05312.1| 502|Caenorhabditis elegans Hypothetical pr... 28 4.6 Z78015-3|CAB01435.1| 448|Caenorhabditis elegans Hypothetical pr... 27 6.0 U41534-6|AAB47598.1| 375|Caenorhabditis elegans Hypothetical pr... 27 8.0 >Z82287-2|CAB05312.1| 502|Caenorhabditis elegans Hypothetical protein ZK550.2 protein. Length = 502 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 362 IMSLGVFHLFYVIHVPWYF 306 + LGVF F+V++ PW+F Sbjct: 335 LFGLGVFVAFHVVNYPWWF 353 >Z78015-3|CAB01435.1| 448|Caenorhabditis elegans Hypothetical protein R02D5.6 protein. Length = 448 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 400 DGDRVYGTAHGNRSCLWAYFIYFTLYMFLGIL 305 DGDRV GT H N S + F Y T + +L Sbjct: 192 DGDRVVGTRHLNLSNEFPTFRYATFHFIFIVL 223 >U41534-6|AAB47598.1| 375|Caenorhabditis elegans Hypothetical protein C16A3.4 protein. Length = 375 Score = 27.1 bits (57), Expect = 8.0 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -2 Query: 500 DRAFLRS*YSCVF*LTYDVNIIRICTISPDVKIRW*QSIWHC 375 DR +L C+ L V R C PDVK R+ +S+ C Sbjct: 191 DRQYLSDELGCLSYLGLKVGAGRCCIFCPDVKARY-ESVQSC 231 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,389,329 Number of Sequences: 27780 Number of extensions: 267593 Number of successful extensions: 582 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -