BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30234 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10310.1 68417.m01696 sodium transporter (HKT1) identical to ... 29 1.9 At4g20860.1 68417.m03026 FAD-binding domain-containing protein s... 28 4.3 >At4g10310.1 68417.m01696 sodium transporter (HKT1) identical to sodium transporter AtHKT1 [Arabidopsis thaliana] gi|7716474|gb|AAF68393 Length = 506 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 364 RSCLWAYFIYFTLYMFLGILLL 299 RS + YFIYF + FLG L L Sbjct: 19 RSLFFLYFIYFLFFSFLGFLAL 40 >At4g20860.1 68417.m03026 FAD-binding domain-containing protein simlar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 530 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 148 WLVLCTESESGCPTRQRSQYLGNCASFKRFGRSV 249 +LVLC +S PTR++ Q NC S K+F ++ Sbjct: 12 FLVLCVKSVYSTPTREQFQ---NCLSTKQFNSTL 42 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,411,938 Number of Sequences: 28952 Number of extensions: 235640 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -