BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30232 (495 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 24 0.77 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 24 0.77 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 24 0.77 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 24 0.77 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 24 0.77 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 24 0.77 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 4.1 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 4.1 AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synth... 22 4.1 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 9.5 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.5 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.5 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.5 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V + HHR Sbjct: 258 GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V + HHR Sbjct: 258 GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V + HHR Sbjct: 258 GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V + HHR Sbjct: 258 GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V + HHR Sbjct: 258 GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V + HHR Sbjct: 258 GSYFNCIMFMVASSVVLTVLVLIFHHR 284 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V HHR Sbjct: 326 GSYFNCIMFMVASSVVLTVLVLNFHHR 352 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 490 GTYLXVVVFEDHRAVTLPAVVTVLHHR 410 G+Y ++F +V L +V HHR Sbjct: 326 GSYFNCIMFMVASSVVLTVLVLNFHHR 352 >AY343324-1|AAQ21381.1| 156|Apis mellifera vacuolar H+ ATP synthase 16 kDa proteolipidsubunit protein. Length = 156 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 218 GGGWIPSGYCSPRGYVHLPA 159 GG P GY +G+VHL A Sbjct: 77 GGLEEPKGYTLFKGFVHLGA 96 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 20.6 bits (41), Expect = 9.5 Identities = 5/16 (31%), Positives = 13/16 (81%) Frame = -1 Query: 318 TASLTFFFLCLIFLGV 271 ++S++F+ C++ LG+ Sbjct: 196 SSSISFYVPCIVMLGI 211 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 20.6 bits (41), Expect = 9.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 167 LPAAFQQRSTSVDWEGFPLCLEF*LSHSRWYLTARPQ 57 +P+A Q STS+ F + + LS+ Y +PQ Sbjct: 404 IPSALQSYSTSMRDPAFYMLYQKILSYFLRYKKLQPQ 440 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 20.6 bits (41), Expect = 9.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 167 LPAAFQQRSTSVDWEGFPLCLEF*LSHSRWYLTARPQ 57 +P+A Q STS+ F + + LS+ Y +PQ Sbjct: 404 IPSALQSYSTSMRDPAFYMLYQNILSYFLRYKKLQPQ 440 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 338 DENGKIHRLRRECTGEQ 388 + +GK+HR R TGE+ Sbjct: 158 EHSGKLHRHMRIHTGER 174 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 Query: 190 QYPEGIHPPPGVEASWW 240 +YP PPP + S W Sbjct: 658 EYPPDSDPPPPDDISGW 674 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,727 Number of Sequences: 438 Number of extensions: 2328 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -