BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30231 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual 25 5.1 SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schi... 25 6.7 SPBC428.19c |||U3 snoRNP protein Utp15 |Schizosaccharomyces pomb... 25 6.7 >SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 25.4 bits (53), Expect = 5.1 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 169 KYPQACGWTLVFLLSPVWFPGKNRTTPSHPV 261 ++P A GWT++ L+ + F T +P+ Sbjct: 671 RFPNAYGWTVIKHLTEILFEQNTSTAYMNPI 701 >SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 25.0 bits (52), Expect = 6.7 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 134 IVHINMKNTHFSNTLRLAAGLLYFYYHLCG-SRVRIGPLHLI 256 +V + +T + L+L GL+YF Y G S + P+H + Sbjct: 325 LVQYSPIDTFAEHKLQLVGGLVYFLYPPLGLSEALLHPVHTV 366 >SPBC428.19c |||U3 snoRNP protein Utp15 |Schizosaccharomyces pombe|chr 2|||Manual Length = 494 Score = 25.0 bits (52), Expect = 6.7 Identities = 8/12 (66%), Positives = 12/12 (100%) Frame = -1 Query: 264 IHGMRWSGPILT 229 +HGM++SGPIL+ Sbjct: 285 VHGMKYSGPILS 296 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,099,123 Number of Sequences: 5004 Number of extensions: 42285 Number of successful extensions: 82 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -