BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30221 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 27 0.50 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 25 1.1 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 25 2.0 Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase pr... 23 4.6 AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding pr... 23 6.1 AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. 23 6.1 AF458073-1|AAL68639.1| 166|Anopheles gambiae D7-related 5 prote... 23 8.1 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 26.6 bits (56), Expect = 0.50 Identities = 22/82 (26%), Positives = 29/82 (35%) Frame = +3 Query: 42 FILITLICACVNAAKTTYKICVPSQHLKACQDMVDIPTKSKVTLDCIPARDRMECLNYVQ 221 F L CAC A Y +C P++ L C T T C D +C+ Y Sbjct: 15 FTLQNAHCACPYAHPYPYDLCGPNEELLEC------GTACPKT--CADLNDPPKCVRYSV 66 Query: 222 QRQADFVPVDPEDMYVAAKIPN 287 R A E +Y+ N Sbjct: 67 YRDASASLDSSESLYMGNAFRN 88 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 25.4 bits (53), Expect = 1.1 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 42 FILITLICACVNAAKTTYKICVPSQHLKAC 131 F L CAC A Y +C P++ + C Sbjct: 15 FTLQNAHCACPYAHPYPYDVCGPNEEFQTC 44 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 42 FILITLICACVNAAKTTYKICVPSQHLKAC 131 F L CAC A Y +C P++ + C Sbjct: 15 FTLQNAHCACPYAHPYPYDLCGPNEEFQEC 44 >Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase protein. Length = 247 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 360 IVIHKDLPINNLDQLKGLKSCHTGVNRNV 446 +V H D+PI LDQ + +K + + N+ Sbjct: 149 LVQHVDVPILTLDQCRSMKYRASRITSNM 177 >AJ618928-1|CAF02007.1| 285|Anopheles gambiae odorant-binding protein OBPjj83a protein. Length = 285 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 240 VPVDPEDMYVAAKIPNQD 293 +P D D+YV PN D Sbjct: 180 IPKDRRDLYVQGVFPNDD 197 >AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. Length = 190 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 462 EGSCIPRFC*LQYDRTSSLSAGPDCLSV 379 EG+C LQ +R S + G +CL++ Sbjct: 130 EGNCTVIIALLQKNRRSRRNMGVECLTI 157 >AF458073-1|AAL68639.1| 166|Anopheles gambiae D7-related 5 protein protein. Length = 166 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 27 MALKYFILITLICACVNAAKTTYKICV 107 M +YF++I LIC + CV Sbjct: 1 MEWRYFVVIALICPLIIVETLAVSDCV 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,442 Number of Sequences: 2352 Number of extensions: 12550 Number of successful extensions: 28 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -