BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30219 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48178| Best HMM Match : RVT_1 (HMM E-Value=0.013) 29 2.3 SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) 27 6.9 >SB_48178| Best HMM Match : RVT_1 (HMM E-Value=0.013) Length = 1105 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/39 (25%), Positives = 25/39 (64%) Frame = -2 Query: 515 VSVHANIFSEVCQPLFFIIV*NGVRIIGFVNEVVVFLVN 399 VSVH +F+++ +P+ + G ++GF++++++ N Sbjct: 758 VSVHPRVFTKLMKPVLASLREKGNLLVGFIDDILLLAEN 796 >SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1387 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 344 VNFLQHFHIHKHFRVYFIRSRNNETVAIRALDNSDVEGIQELT 216 VN +Q F + ++ +SR+ + +R DN D EG+ E T Sbjct: 658 VNDIQDFAFSNNMKLNPAKSRHQAFIPLRCKDNGDREGMFEAT 700 >SB_4921| Best HMM Match : Myosin_head (HMM E-Value=7.39998e-41) Length = 1017 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 264 CHGFVVPAPYEVYPKMFMNMEVLQKIYVTKMQDGLI 371 C F+V P + K +++ +QKI V+ ++DGL+ Sbjct: 849 CSEFIVADPKSMSAKYRVSLGDVQKISVSPLKDGLV 884 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,926,992 Number of Sequences: 59808 Number of extensions: 282704 Number of successful extensions: 624 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -