BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30219 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 33 0.11 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 33 0.11 At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi... 31 0.46 At2g36305.1 68415.m04456 CAAX amino terminal protease family pro... 30 1.1 At3g45530.1 68416.m04917 DC1 domain-containing protein contains ... 27 5.7 At4g23930.2 68417.m03442 expressed protein hin1 protein homolog,... 27 9.9 At1g68480.1 68414.m07823 zinc finger (C2H2 type) family protein ... 27 9.9 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 33.1 bits (72), Expect = 0.11 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -2 Query: 314 KHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 156 K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 828 KMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 33.1 bits (72), Expect = 0.11 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -2 Query: 314 KHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGSLVERFKVLS 156 K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 828 KMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing protein contains similarity to 67kD chloroplastic RNA-binding protein, P67.1 [Raphanus sativus] GI:9755886; contains Pfam profile PF01535: PPR repeat Length = 711 Score = 31.1 bits (67), Expect = 0.46 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 33 KAVEEFLKMYRTGFMPKNLEFSVFYD 110 KA+E F +MY+TG MP + +S D Sbjct: 239 KAIEWFERMYKTGLMPDEVTYSAILD 264 >At2g36305.1 68415.m04456 CAAX amino terminal protease family protein similar to CAAX prenyl protease 2 (EC 3.4.22.-) (Prenyl protein-specific endoprotease 2) (Farnesylated-proteins converting enzyme 2) (FACE-2) from Mus musculus [SP|P57791], Homo sapiens [SP|Q9Y256], Drosophila melanogaster [SP|Q9U1H8]; contains Pfam profile PF02517 CAAX amino terminal protease family protein Length = 242 Score = 29.9 bits (64), Expect = 1.1 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -2 Query: 428 VNEVVVF---LVNAILSCGFRINEAILHLCYVNF-LQHFHIHKHFRVYFIR 288 V E +VF ++ +L GFRIN AI LC V F L H + HFR +IR Sbjct: 93 VTEELVFRSCMIPLLLCAGFRINTAIF-LCPVLFSLAHLN---HFREMYIR 139 >At3g45530.1 68416.m04917 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 692 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 340 IFCSTSIFINILGYTSYGAGTTKPW 266 ++CS + LGYT GA T PW Sbjct: 640 VYCSCYCVSSQLGYTYKGADTCPPW 664 >At4g23930.2 68417.m03442 expressed protein hin1 protein homolog, Oryza sativa, PIR:T02662 Length = 160 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 51 LKMYRTGFMPKNLEFSVFYDKMRDEAIALFHLFYY 155 L +Y T F P++ E SV K+ ++A LFYY Sbjct: 26 LTVYLTVFRPRDPEISVTSVKVPSFSVANSSLFYY 60 >At1g68480.1 68414.m07823 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 253 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +3 Query: 324 EVLQKIYVTKMQDGLINPEAAAKYGIHKENDYFVYKANYSNAVLY 458 E L + ++ I P + +G H D +Y++ YS+ ++Y Sbjct: 80 ETLNQARQLVYRNDTITPPGISPFGYHHTTDPTIYRSVYSSPMIY 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,349,537 Number of Sequences: 28952 Number of extensions: 198343 Number of successful extensions: 486 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -