BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30218 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11310.1 68414.m01299 seven transmembrane MLO family protein ... 32 0.26 At1g27260.1 68414.m03321 paired amphipathic helix repeat-contain... 29 2.5 At5g28930.1 68418.m03578 hypothetical protein various predicted ... 27 7.5 At3g11710.1 68416.m01435 lysyl-tRNA synthetase, putative / lysin... 27 7.5 At2g22560.1 68415.m02674 kinase interacting protein-related simi... 27 7.5 At4g19440.1 68417.m02860 pentatricopeptide (PPR) repeat-containi... 27 9.9 At3g14790.1 68416.m01869 NAD-dependent epimerase/dehydratase fam... 27 9.9 At2g48020.2 68415.m06011 sugar transporter, putative similar to ... 27 9.9 At2g48020.1 68415.m06010 sugar transporter, putative similar to ... 27 9.9 At2g26810.1 68415.m03217 expressed protein and genefinder 27 9.9 At1g53500.1 68414.m06066 NAD-dependent epimerase/dehydratase fam... 27 9.9 At1g52650.1 68414.m05945 F-box family protein contains F-box dom... 27 9.9 >At1g11310.1 68414.m01299 seven transmembrane MLO family protein / MLO-like protein 2 (MLO2) idenctical to membrane protein Mlo2 [Arabidopsis thaliana] gi|14091574|gb|AAK53795; similar to Mlo [Hordeum vulgare subsp. vulgare] gi|1877221|emb|CAB06083 SWISS-PROT:P93766 Length = 573 Score = 31.9 bits (69), Expect = 0.26 Identities = 26/115 (22%), Positives = 52/115 (45%), Gaps = 3/115 (2%) Frame = +2 Query: 125 KTLMPNFFEDIDVKKFAFSTVFSHAHMPKLTKDNYRIYILKVYNDDFDASLVLDY--YKY 298 KT+ + D + +FA T F H+ +K ++I+ + F + +DY ++ Sbjct: 200 KTIEYQYSNDPERFRFARDTSFGRRHLNFWSKTRVTLWIVCFFRQFFGSVTKVDYLALRH 259 Query: 299 IVVVSEYLKIHDYCKGFEVILDYSDVNVMNFVTKFNPVILRQAVT-LITDGYGMR 460 +++ + ++ F + S V + +PVI AV L+T+ YG+R Sbjct: 260 GFIMAHFAPGNESRFDFRKYIQRSLEKDFKTVVEISPVIWFVAVLFLLTNSYGLR 314 >At1g27260.1 68414.m03321 paired amphipathic helix repeat-containing protein low similarity to transcriptional repressor SIN3B [Mus musculus] GI:2921547; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 222 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 77 GLVERAKTRIDNLCTFKTLMPNFFEDIDVKKFAFSTVFSHAHMPKLTKDNYRIYILKV 250 GLVE K +D L F L+P F+ I + F V + P+ T ++ Y+ V Sbjct: 45 GLVELIKDHLDLLLGFNALLPARFQ-IPITPAGFQNVVGRSVPPETTIEDATSYLNSV 101 >At5g28930.1 68418.m03578 hypothetical protein various predicted proteins, Arabidopsis thaliana Length = 509 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 320 LKIHDYCKGFEVILDYSDVNVMNFVTKFNPVI 415 L IHD +GF+V D +++ + NPVI Sbjct: 340 LTIHDTTRGFDVAPDRVEISGIQVHVSLNPVI 371 >At3g11710.1 68416.m01435 lysyl-tRNA synthetase, putative / lysine--tRNA ligase, putative similar to SP|Q43776 Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase) {Lycopersicon esculentum}; contains Pfam profile PF00152: tRNA synthetases class II (D, K and N) Length = 626 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/43 (23%), Positives = 24/43 (55%) Frame = +2 Query: 230 RIYILKVYNDDFDASLVLDYYKYIVVVSEYLKIHDYCKGFEVI 358 +++ ++ DDF ++ D K + +E+LK+H K +++ Sbjct: 155 KLFFYDLHGDDFKVQVMADASKSGLDEAEFLKLHSNAKRGDIV 197 >At2g22560.1 68415.m02674 kinase interacting protein-related similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia]; weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum Length = 891 Score = 27.1 bits (57), Expect = 7.5 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +2 Query: 83 VERAKTRIDNLCTFKTLMPNFF--EDIDVKKFAFSTVFSHAHMPKLTK 220 ++ A T I ++ F +PNF +DID+ KFA + S A++P + K Sbjct: 34 LQNANTTIASV--FPDQVPNFAMDDDIDMSKFAKRSNISGANVPNVPK 79 >At4g19440.1 68417.m02860 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 825 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -1 Query: 222 SLVSFGICACEKTVENANFLTSMSSKKFGISVLNVHKLSIRVLARSTRPFVVISVR 55 S++ G C E+T E F M SK + + V+ IR RS R + + +R Sbjct: 614 SVMIDGCCKAERTEEGQEFFDEMMSKNVQPNTV-VYNHLIRAYCRSGRLSMALELR 668 >At3g14790.1 68416.m01869 NAD-dependent epimerase/dehydratase family protein similar to dTDP-glucose 4,6-dehydratase from Aneurinibacillus thermoaerophilus GI:16357461, Saccharopolyspora spinosa GI:15077647, RmlB from Leptospira borgpetersenii GI:4234803; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family Length = 664 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 71 TKGLVERAKTRIDNLCTFKTLMP 139 TK +VE DN+CT + MP Sbjct: 514 TKAMVEELLREFDNVCTLRVRMP 536 >At2g48020.2 68415.m06011 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 463 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +2 Query: 299 IVVVSEYLKIHDYCKGFEVILDYSDVNVMNFVTKFNPVILRQAVTLITDGYGMRIKGV 472 I VS YLK+HD E + + V +M ++ F+ + ++++ + + IKGV Sbjct: 341 IAAVSFYLKVHD--MAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGV 396 >At2g48020.1 68415.m06010 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 463 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +2 Query: 299 IVVVSEYLKIHDYCKGFEVILDYSDVNVMNFVTKFNPVILRQAVTLITDGYGMRIKGV 472 I VS YLK+HD E + + V +M ++ F+ + ++++ + + IKGV Sbjct: 341 IAAVSFYLKVHD--MAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEIFPINIKGV 396 >At2g26810.1 68415.m03217 expressed protein and genefinder Length = 197 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 239 ILKVYNDDFDASLVLDYYKYIVVVSEYLKI 328 ILK +ND FD L+L YI++V + L+I Sbjct: 105 ILKKHNDGFD--LILGAEIYILIVEQLLRI 132 >At1g53500.1 68414.m06066 NAD-dependent epimerase/dehydratase family protein low similarity to dTDP-D-glucose-4,6-dehydratase from Aneurinibacillus thermoaerophilus GI:16357461, Sphingomonas sp. GI:1314581; contains Pfam profile PF01370: NAD dependent epimerase/dehydratase family; putative NDP-rhamnose synthase (rhm2 gene) GI:31559258 Length = 667 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 71 TKGLVERAKTRIDNLCTFKTLMP 139 TK +VE DN+CT + MP Sbjct: 517 TKAMVEELLREFDNVCTLRVRMP 539 >At1g52650.1 68414.m05945 F-box family protein contains F-box domain Pfam:PF00646 Length = 465 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/57 (19%), Positives = 25/57 (43%) Frame = -3 Query: 388 IHDIHVAVVKYYFKTFAVIMNFKVFAHNHNVLVIVQDEGSVKIIVVNF*YIYSVVIL 218 +H + + V K++F+ + +FA + + S+K + + F Y + L Sbjct: 166 LHSVKLCVDKFFFRALPALEELVLFAVSWRDRDVTVSNASIKTLTIKFNYYLGTLSL 222 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,345,410 Number of Sequences: 28952 Number of extensions: 230527 Number of successful extensions: 543 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -