BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30212 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.43 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 31 0.74 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 30 0.98 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45) 29 2.3 SB_25448| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_33280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) 28 4.0 SB_40330| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) 28 5.3 SB_23488| Best HMM Match : PSI_8 (HMM E-Value=5) 28 5.3 SB_6363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_35683| Best HMM Match : Amino_oxidase (HMM E-Value=0.0092) 28 5.3 SB_29619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_8029| Best HMM Match : Mucin (HMM E-Value=8.6) 27 6.9 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_44756| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_6584| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.01) 27 9.2 SB_3615| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1277 Score = 31.5 bits (68), Expect = 0.43 Identities = 24/63 (38%), Positives = 30/63 (47%) Frame = +3 Query: 6 TSRLSTPFTIHLPKEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTV 185 T R S H + + TT RR + AS T R SSNT+ + T RPS K+L T Sbjct: 1113 TGRSSNTTRSHTRRSSNTTRGHTRRQVTQLASHT---RRSSNTTRRHTRRPS-KQLAVTQ 1168 Query: 186 AKQ 194 Q Sbjct: 1169 GGQ 1171 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 30.7 bits (66), Expect = 0.74 Identities = 22/68 (32%), Positives = 33/68 (48%) Frame = +3 Query: 45 KEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRR 224 KE+ + RR K+ S+ M R S ++ +R +KL VA T T GR+ Sbjct: 1127 KESTRSRAENRRRAKEEMSA--MERELEEASEQIKAREQ-EKLNKHVASVRTKIVTPGRK 1183 Query: 225 TPIYSKKT 248 TP+ K+T Sbjct: 1184 TPVTPKRT 1191 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 30.3 bits (65), Expect = 0.98 Identities = 19/68 (27%), Positives = 31/68 (45%) Frame = +3 Query: 3 ATSRLSTPFTIHLPKEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICT 182 A R++TP T + + T C R ++ R H++NT SR T LIC+ Sbjct: 197 ALERIATPVTTSKLRCSTTQECCVRVDYRRKCCLHVWRVHTTNTYWSSLSRVGT-GLICS 255 Query: 183 VAKQSTLW 206 + + + W Sbjct: 256 IKQVNPRW 263 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 29.9 bits (64), Expect = 1.3 Identities = 23/84 (27%), Positives = 36/84 (42%) Frame = +3 Query: 9 SRLSTPFTIHLPKEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVA 188 SR +TP ++ + + TS T+R+T R +S TS K + T + Sbjct: 135 SRTTTPTHRNISETGLRTSATSRKTFSNI-------RPTSETSRKTSGNSGTTTAVSLTI 187 Query: 189 KQSTLWATTGRRTPIYSKKTSSNS 260 S+ T RT I S + S +S Sbjct: 188 SVSSRKLPTSTRTYIKSSEASRSS 211 >SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45) Length = 649 Score = 29.1 bits (62), Expect = 2.3 Identities = 27/71 (38%), Positives = 37/71 (52%) Frame = +3 Query: 57 TTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIY 236 TT T +TTK A++T +S T + TS ST K T++ ST ATT TP Sbjct: 447 TTEATKSQTTK--ATTTL---STSTTKATTTSSTSTTKATTTLS-TSTTKATT---TPST 497 Query: 237 SKKTSSNSTSV 269 S ++ ST+V Sbjct: 498 STTKATTSTAV 508 >SB_25448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 538 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = +3 Query: 75 RRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIYS 239 RR +K A S+ M S T++ S P + A + LW T RRT + S Sbjct: 232 RRRSKALAPSSRMHAAHSMTAAGTASAPGPGEKSDHTALKFALWMTFERRTTVLS 286 >SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = +3 Query: 75 RRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIYS 239 RR +K A S+ M S T++ S P + A + LW T RRT + S Sbjct: 132 RRRSKALAPSSRMHAAHSMTAAGTASAPGPGEKSDHTALKFALWMTFERRTTVLS 186 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 28.7 bits (61), Expect = 3.0 Identities = 20/70 (28%), Positives = 34/70 (48%) Frame = +3 Query: 57 TTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIY 236 TTS T +T ++ST ++NTS+ TS P T T A ++ + + R P Sbjct: 11 TTSITTSTSTP--STSTPRAGSTTNTSAPSTSTPRTGSTTTTSAPSTSTTSNSTTRAPST 68 Query: 237 SKKTSSNSTS 266 S + ++T+ Sbjct: 69 STPRAGSTTT 78 Score = 27.5 bits (58), Expect = 6.9 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 6/94 (6%) Frame = +3 Query: 3 ATSRLSTPFTIHLPKEAMTTSCTARRT-TKKFASSTFMRRHS-SNTSSKVTSRPSTKK-- 170 +T+ S P T P+ TT+ +A T T + S+T S S TS+ T PST Sbjct: 75 STTTTSAPST-STPRTGSTTTTSAPSTSTPRTGSTTTTSAPSTSTTSNSTTRAPSTSTPR 133 Query: 171 --LICTVAKQSTLWATTGRRTPIYSKKTSSNSTS 266 T+ +T TT T S+ S+ +TS Sbjct: 134 TGSTITLRTSTTSVMTTTPSTTSISRAGSTTTTS 167 >SB_33280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.7 bits (61), Expect = 3.0 Identities = 21/75 (28%), Positives = 30/75 (40%) Frame = +3 Query: 6 TSRLSTPFTIHLPKEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTV 185 T+ P TI E TT T TT ++T + ++ T P+T I T Sbjct: 16 TTTTEEPTTI---TETTTTKTTEEPTTITETTTTTEEPTTITETTTTTEEPTTITEITTT 72 Query: 186 AKQSTLWATTGRRTP 230 ++ T TT TP Sbjct: 73 TEEPTTTTTTAAETP 87 >SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2353 Score = 28.7 bits (61), Expect = 3.0 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 111 MRRHSSNTSSKVTSRPSTKK-LICTVAKQSTLWATTGRRTPIYSKKTSSNSTS 266 +R+ S N S K ++CT+ K T RT SK ++ NSTS Sbjct: 2196 LRKCSENVSRKAQEHCRVAPYMVCTLTKSCRYQTATRTRTVRLSKASNENSTS 2248 >SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) Length = 294 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +2 Query: 221 TNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQ 391 T AD+F +D FYQ+S + ++ +PK SA Y S + P+ YQ Sbjct: 54 TRADMFYQDPFLFYQQSPHYSPHNIVPPSPKYSPHLMGDCSAQSAYFVS-KQPSHYQ 109 >SB_40330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 4.0 Identities = 29/87 (33%), Positives = 38/87 (43%) Frame = +3 Query: 6 TSRLSTPFTIHLPKEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTV 185 TS STP TTS T +T + S+T +S TS+ TS ST T Sbjct: 18 TSYTSTPSYTSTTSYTSTTSYT---STSSYTSTTSYTSTTSYTST--TSYTSTPSYTSTT 72 Query: 186 AKQSTLWATTGRRTPIYSKKTSSNSTS 266 + ST T+ T Y+ TS ST+ Sbjct: 73 SYTST---TSYTSTTSYTSTTSYTSTT 96 >SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/70 (25%), Positives = 37/70 (52%) Frame = +3 Query: 57 TTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGRRTPIY 236 TTS + ++ ++T + TSS V P+T ++ + + S++ T+ TP+ Sbjct: 443 TTSTPSLESSMTSNNTTLTLAEAVATSSPVL--PTTTSVLTSSMEPSSMATTSTTSTPLE 500 Query: 237 SKKTSSNSTS 266 S T++++TS Sbjct: 501 SSMTTNSTTS 510 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 287 RRVLGAAPKPFNQ--YTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPY 448 R VL A KP+ Y F +ALD ++T +D Y + + + EF Q + Y Sbjct: 182 RYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEY 237 >SB_27474| Best HMM Match : MANEC (HMM E-Value=0.0026) Length = 3342 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 63 SCTARRTTKKFASSTFMRRHSSNTSSKVTSRPST 164 S +R KF+S+T+ R+ S+ S VTS+ T Sbjct: 2937 SADSRNKIDKFSSTTYSRKKESSGKSDVTSKTVT 2970 >SB_23488| Best HMM Match : PSI_8 (HMM E-Value=5) Length = 192 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +2 Query: 212 YWQTNADLFEEDFLQFYQRSYEVNARRVLGA--APKPFNQYTFIPSALDFYQTSA 370 Y T L ++ LQFY + Y + PK + QYTF + + Y +SA Sbjct: 93 YIPTCVQLRHKNLLQFYVKKYVACLMFATSSDFCPKEYEQYTFADTWIASYLSSA 147 >SB_6363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 5/65 (7%) Frame = +2 Query: 317 FNQYTFIPSALDFYQTSARDPAFYQLYKR-----IVQYIIEFKQYQVPYTQEALHFVGLK 481 + QYT + L + Q + + Y R QY I + QY YT+ ALH + Sbjct: 60 YRQYTSRNTLLAYTQYAIHYTQYATRYTRNALLAYTQYAINYTQYATCYTRNALHAIRFT 119 Query: 482 ISDVK 496 + ++ Sbjct: 120 LHAIR 124 >SB_35683| Best HMM Match : Amino_oxidase (HMM E-Value=0.0092) Length = 729 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 197 NFVGNYWQTNADLFEEDFLQFYQRSYEVNA-RRVLGAAPKPFNQYT 331 N G WQ+ ADL + F R ++N +++L A K +Y+ Sbjct: 249 NGTGGIWQSVADLLPRSWFHFENRVVQLNIDKKILTVASKDGAKYS 294 >SB_29619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = +2 Query: 134 LQQGHFKAFDKEIDLHSSKAVNFVGNYWQTNADL--FEEDFLQFYQ-RSYEVNARRVLGA 304 LQQ F F +++ KA+ F G W +++ + FYQ + E+ R+ Sbjct: 526 LQQTKFSRFKNSMNVKFGKALKFTGKLWNVGSEVANIAGAAMMFYQIINTEMVCRKRAEE 585 Query: 305 APKPFNQYT 331 A K ++ T Sbjct: 586 AKKALDEIT 594 >SB_8029| Best HMM Match : Mucin (HMM E-Value=8.6) Length = 325 Score = 27.5 bits (58), Expect = 6.9 Identities = 25/90 (27%), Positives = 36/90 (40%), Gaps = 5/90 (5%) Frame = +3 Query: 6 TSRLSTPFTIHLPKEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKK----- 170 T TP TI PK T+ T K ST + ++ T T++PST + Sbjct: 171 TKAPKTPITI--PKTTTNRPQTSTITAKITTESTTATQATTKTKEYTTNKPSTTEESTTN 228 Query: 171 LICTVAKQSTLWATTGRRTPIYSKKTSSNS 260 T +ST A +T Y+ K S + Sbjct: 229 EASTAEFESTTAAQATTKTEAYTTKKPSTT 258 >SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3038 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 369 PGTQPSTSSIKGLFNTSSNL 428 PG+QPST+S GLF++ ++ Sbjct: 261 PGSQPSTNSNNGLFDSGEHV 280 >SB_44756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 27.1 bits (57), Expect = 9.2 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +3 Query: 42 PKEAMTTSCTARRTTKKFASSTFMRRHSSNTSSKVTSRPSTKKLICTVAKQSTLWATTGR 221 P E +T S A A+ + + S N S+K T STK K + ++T Sbjct: 8 PSEYITYSTKATENYSTKATENYSTKASENYSTKATENYSTKASENYSTKATEKYSTKAA 67 Query: 222 RTPIYSKKTSSN 257 YS K + N Sbjct: 68 EN--YSTKATEN 77 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 14 PFNSFYYPFAQRSNDYELHSEKN 82 PF + YPFA +N Y H+ N Sbjct: 3031 PFANHNYPFANHNNPYAKHNNPN 3053 >SB_6584| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.01) Length = 742 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 369 PGTQPSTSSIKGLFNTSSNL 428 PG+QPST+S GLF++ ++ Sbjct: 389 PGSQPSTNSNNGLFDSGEHV 408 >SB_3615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 369 PGTQPSTSSIKGLFNTSSNL 428 PG+QPST+S GLF++ ++ Sbjct: 135 PGSQPSTNSNNGLFDSGEHV 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,783,807 Number of Sequences: 59808 Number of extensions: 271374 Number of successful extensions: 854 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -