BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30210 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 29 0.55 SPCC126.05c |mrpl17||mitochondrial ribosomal protein subunit L17... 27 2.2 SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pomb... 27 2.2 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 26 2.9 SPAC12B10.11 |exg2||glucan 1,3-beta-glucosidase Exg2|Schizosacch... 26 3.8 SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb... 25 6.7 SPBC56F2.04 |utp20||U3 snoRNP protein Utp20|Schizosaccharomyces ... 25 8.9 SPAC29E6.02 |prp3|SPAC30.06|U4/U6 x U5 tri-snRNP complex subunit... 25 8.9 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 28.7 bits (61), Expect = 0.55 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +2 Query: 389 KEGDYELDPKLKKDAVEVFDADFEKVD---FDNGAAAAGLINKW 511 K+G L+PK+ + V + +++EK+D FD+ GL++ + Sbjct: 1277 KDGSGVLEPKIAANTVNQYPSEWEKIDLKVFDDLETTEGLLSSY 1320 >SPCC126.05c |mrpl17||mitochondrial ribosomal protein subunit L17|Schizosaccharomyces pombe|chr 3|||Manual Length = 268 Score = 26.6 bits (56), Expect = 2.2 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +2 Query: 92 IKNPVLSMDSKALSSAITKFSAKFCNELDKKKNVVSSPLSAEYLLALITLGTTD 253 I++P+L+ +I K++A+ NEL S PL AE+ ++G D Sbjct: 48 IRSPILTRQPSEFEKSIYKYNAELWNEL-------SDPLPAEFYFKKGSVGEKD 94 >SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 26.6 bits (56), Expect = 2.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 365 NVANKIYIKEGDYELDPKLKKDAVEVFDADFEKV 466 + ++ Y+K+G +EL + D V D DF+ V Sbjct: 1256 STSDNFYLKQGGFELLDTIITDFSNVMDPDFDDV 1289 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 26.2 bits (55), Expect = 2.9 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 469 VNFFKICIKYLDSV-LLKFWVELIVTLLDVY 380 V F+ C K + + + FW+EL+ TLL VY Sbjct: 1101 VPLFEQCTKEVSAEDVTNFWLELVFTLLLVY 1131 >SPAC12B10.11 |exg2||glucan 1,3-beta-glucosidase Exg2|Schizosaccharomyces pombe|chr 1|||Manual Length = 570 Score = 25.8 bits (54), Expect = 3.8 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 110 SMDSKALSSAITKFSAKFCNELDKKKNVVS 199 S DSK+L + F++K C E+DKK +++ Sbjct: 10 SCDSKSLG--VDDFTSKRCREIDKKALLIT 37 >SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 1018 Score = 25.0 bits (52), Expect = 6.7 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +2 Query: 98 NPVLSMDS--KALSSAITKFSAKFCNELDKKKNVVSSPLSAEYLLALITLGTTDPAHEEL 271 NP +S+D KAL S + + N NV SSP L+ + TD + +E Sbjct: 255 NPEISLDEPIKALPSTTSDAPSSLLNT-----NVSSSPSKFRKFLSSVIPAKTDLSAKES 309 Query: 272 LTS 280 LTS Sbjct: 310 LTS 312 >SPBC56F2.04 |utp20||U3 snoRNP protein Utp20|Schizosaccharomyces pombe|chr 2|||Manual Length = 2493 Score = 24.6 bits (51), Expect = 8.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 279 LVNSSSCAGSVVPKVINASKYSADNGDD 196 L+ SS SV PK++NA Y+ DD Sbjct: 1006 LLQISSKLSSVAPKILNAVLYNLVVSDD 1033 >SPAC29E6.02 |prp3|SPAC30.06|U4/U6 x U5 tri-snRNP complex subunit Prp3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 24.6 bits (51), Expect = 8.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 70 NTIYTIGNKEPCSQYGFKGFILCNHQVL 153 NTI T N++ + + KG L HQ+L Sbjct: 117 NTILTPENRKRTASFSTKGVSLSQHQLL 144 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,941,762 Number of Sequences: 5004 Number of extensions: 36919 Number of successful extensions: 116 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -