BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30209 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) simi... 186 6e-48 At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ... 180 5e-46 At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) 151 2e-37 At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to hom... 31 0.35 At2g02640.1 68415.m00203 DC1 domain-containing protein contain... 31 0.46 At3g28360.1 68416.m03544 ABC transporter family protein similar ... 29 1.4 At2g04330.1 68415.m00429 hypothetical protein contains Pfam prof... 29 1.4 At5g35794.1 68418.m04297 hypothetical protein contains Pfam prof... 29 1.9 At4g03890.1 68417.m00546 hypothetical protein contains Pfam prof... 29 1.9 At2g23480.1 68415.m02803 hypothetical protein contains Pfam prof... 29 1.9 At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-b... 28 3.2 At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-g... 28 3.2 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 28 3.2 At1g05440.1 68414.m00552 expressed protein ; expression supporte... 28 3.2 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 28 4.3 At5g67280.1 68418.m08483 leucine-rich repeat transmembrane prote... 27 5.7 At4g35730.1 68417.m05071 expressed protein contains Pfam profil... 27 5.7 At1g32190.1 68414.m03959 expressed protein 27 5.7 At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-g... 27 7.5 At3g28345.1 68416.m03541 ABC transporter family protein similar ... 27 7.5 >At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) similar to GB:P42791 Length = 187 Score = 186 bits (454), Expect = 6e-48 Identities = 89/163 (54%), Positives = 118/163 (72%) Frame = +3 Query: 21 RKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISVSRLARHM 200 +K +RT KS D+ TN+KFN ++L+RLFMS++N+ P+S+SRL M Sbjct: 12 KKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFM 71 Query: 201 KKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRA 380 +E IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRA Sbjct: 72 TG--KEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRA 129 Query: 381 PTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKGHE 509 P G+ TVL++G +N+REAV+HFGPAPG P SH+KPYVR KG + Sbjct: 130 PLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRK 172 >At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ribosomal protein L18, Arabidopsis thaliana, SWISSPROT:RL18_ARATH Length = 187 Score = 180 bits (438), Expect = 5e-46 Identities = 86/163 (52%), Positives = 117/163 (71%) Frame = +3 Query: 21 RKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISVSRLARHM 200 +K +RT KS D+ +N+ FN ++L+RLFMS++N+ P+S+SRL M Sbjct: 12 KKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKAPLSLSRLVEFM 71 Query: 201 KKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRA 380 ++ IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRA Sbjct: 72 TG--KDDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRA 129 Query: 381 PTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKGHE 509 P G+ TVL++G +N+REAV+HFGPAPG P S+TKPYVR KG + Sbjct: 130 PLGQNTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVRHKGRK 172 >At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) Length = 135 Score = 151 bits (367), Expect = 2e-37 Identities = 74/120 (61%), Positives = 92/120 (76%), Gaps = 1/120 (0%) Frame = +3 Query: 147 MSRINRPPISVSRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARAR 326 MS++N+ P+S+SRL R+M ++G IAV+VGTVT+DVR+ +P +TV AL TE ARAR Sbjct: 1 MSKVNKAPLSLSRLVRYMDG--KDGKIAVIVGTVTDDVRIEDVPALTVTALRFTESARAR 58 Query: 327 ILAAGGEILTFDQLALRAPT-GKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKG 503 I AGGE LTFDQLAL PT + TVL++G +N REAV+HFGPAPG P SHTKPYVR G Sbjct: 59 IHKAGGECLTFDQLALPCPTWSENTVLLRGPKNTREAVKHFGPAPGVPHSHTKPYVRQTG 118 >At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to homeodomain transcription factor (AGL30) GI:3461830 from [Arabidopsis thaliana]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); PMID: 12837945 Length = 389 Score = 31.5 bits (68), Expect = 0.35 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 450 GQSDALPHEHFADLVPVLSSCQSEHEEPADQ 358 G S LPH +PV SSC E +P DQ Sbjct: 223 GDSSFLPHREMDGSIPVYSSCFFESTKPEDQ 253 >At2g02640.1 68415.m00203 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 31.1 bits (67), Expect = 0.46 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 293 CSSCYRKSSCTHFGCWRRNSYF 358 CS+C RKS+ + C+ RN YF Sbjct: 423 CSACMRKSNGFGYSCYNRNCYF 444 >At3g28360.1 68416.m03544 ABC transporter family protein similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1158 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 345 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 437 E L FD L L+ P+GK LV G + + V Sbjct: 290 ETLIFDDLCLKIPSGKTVALVGGSGSGKSTV 320 >At2g04330.1 68415.m00429 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 564 Score = 29.5 bits (63), Expect = 1.4 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -3 Query: 274 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRDTEIGGRLIRLIKSR 137 +LY LTS + VPT T + S + F RA D I ++ R Sbjct: 347 VLYFLTSSIVVPTKTGERASPIDDFCVRAASDLTFSFEAIPSLRER 392 >At5g35794.1 68418.m04297 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 662 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 274 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 179 +LY LTS + VPT T + S + F RA D Sbjct: 377 VLYFLTSIIAVPTKTGERASPIDDFCVRAASD 408 >At4g03890.1 68417.m00546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 301 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -3 Query: 277 GILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 179 G+LY LTS + V T T K S V F RA D Sbjct: 101 GVLYFLTSIIVVLTKTGEKGSPVDNFCLRAASD 133 >At2g23480.1 68415.m02803 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 705 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 274 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 179 +LY LTS + VPT T + S + F RA D Sbjct: 440 VLYFLTSIIAVPTKTGERASPIDDFCVRAASD 471 >At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-binding cassette; related to multi drug resistance proteins Length = 1221 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 357 FDQLALRAPTGKKTVLVQGQRNAREAV 437 FD L LR P+GK LV G + + V Sbjct: 356 FDDLCLRIPSGKSVALVGGSGSGKSTV 382 >At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1225 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 357 FDQLALRAPTGKKTVLVQGQRNAREAV 437 FD L LR P+GK LV G + + V Sbjct: 365 FDDLCLRVPSGKTVALVGGSGSGKSTV 391 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 257 RETVQDTEDDGGCSSCY--RKSSCTHFGCWRRNSYF*SAGSSCS 382 R+ + +E GGC+SC KS T C R+ + S G+ CS Sbjct: 145 RDHGECSESVGGCASCIVRSKSDITTSQCGDRDRRYTSPGNPCS 188 >At1g05440.1 68414.m00552 expressed protein ; expression supported by MPSS Length = 393 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 434 CLTSISLTLYQYCLLASRSTKSQLIKSKNFSSSSQNACTSF 312 CL S++ TL L +S+ ++L + NF S+ ++ TSF Sbjct: 71 CLDSLNATLDLMPLSVQKSSLTKLSSASNFKSTVESTPTSF 111 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 120 NQIVLRRLFMSRINRPPISVSRLARHMKKPTREGLI 227 +Q V + S INRPP+ + H R+GL+ Sbjct: 34 SQTVHSHAYHSGINRPPVETKPVTEHKSFTRRDGLL 69 >At5g67280.1 68418.m08483 leucine-rich repeat transmembrane protein kinase, putative Length = 751 Score = 27.5 bits (58), Expect = 5.7 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = -1 Query: 345 LLQQPKCVHELFR*HEEQPPS-SSVSCTVS-RHL*LSPLPRQSNPHELASSCGAPNETQR 172 ++ P V +R +E P S V+C S RH+ + LP + L S+ G+ N QR Sbjct: 45 IVDDPLYVFRSWRFDDETPCSWRGVTCDASSRHVTVLSLPSSNLTGTLPSNLGSLNSLQR 104 Query: 171 L 169 L Sbjct: 105 L 105 >At4g35730.1 68417.m05071 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 430 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 284 DGGCSSCYRKSSCTHFGCWRRNSYF*SAGSSCSDWQEDSTGTRS 415 D SS Y K + G RR+SY + G + SD++E+ T T + Sbjct: 289 DSETSSYYAKPGAENRGMGRRHSYN-NPGINESDYEEEYTNTEA 331 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 27.5 bits (58), Expect = 5.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 293 CSSCYRKSSCTHFGCWR 343 CSSC+ K C CW+ Sbjct: 359 CSSCFGKPKCPKCSCWK 375 >At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1240 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 345 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 437 E FD L L+ P GK LV G + + V Sbjct: 373 ETTIFDDLCLKIPAGKTVALVGGSGSGKSTV 403 >At3g28345.1 68416.m03541 ABC transporter family protein similar to P-glycoprotein [Arabidopsis thaliana] GI:3849833; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1240 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 345 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 437 E FD LR P+GK LV G + + V Sbjct: 373 ETSIFDDFCLRVPSGKTVALVGGSGSGKSTV 403 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,024,172 Number of Sequences: 28952 Number of extensions: 263312 Number of successful extensions: 765 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -