BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30206 (369 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.25 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 22 2.3 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 22 2.3 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 22 2.3 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 20 7.0 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 20 9.2 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.0 bits (52), Expect = 0.25 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 26 SAECPPDQYDPGP-NCAFETICALRSAHSNRKHYC 127 S C P QY P P NC C L RK YC Sbjct: 1100 SQPCEPGQYVPDPHNCNAYYRCVLGEL---RKQYC 1131 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 230 DLITVRAYR*CNFLCEILNKC 292 DL+T +YR F E+L KC Sbjct: 135 DLVTRPSYRLRKFFDELLFKC 155 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 230 DLITVRAYR*CNFLCEILNKC 292 DL+T +YR F E+L KC Sbjct: 368 DLVTRPSYRLRKFFDELLFKC 388 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 230 DLITVRAYR*CNFLCEILNKC 292 DL+T +YR F E+L KC Sbjct: 368 DLVTRPSYRLRKFFDELLFKC 388 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 20.2 bits (40), Expect = 7.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 31 GMSTGPIRSGSKLRLRDNLCITKRTL 108 G +TG +R S R L KRT+ Sbjct: 169 GGTTGKLRRRSTAASRSRLAAFKRTI 194 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 19.8 bits (39), Expect = 9.2 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 Query: 101 AHSNRKHYCDCWCKP 145 A+S YCD W P Sbjct: 26 AYSPPPSYCDPWYNP 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,524 Number of Sequences: 336 Number of extensions: 1691 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7616520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -