BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30206 (369 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 0.66 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 1.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 1.5 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 4.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 20 8.1 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 0.66 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 131 CWCKPGLIRDSIAHKCVKECP 193 C CKPG D +C ECP Sbjct: 247 CHCKPGYQADVEKQECT-ECP 266 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.0 bits (47), Expect = 1.1 Identities = 9/33 (27%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +2 Query: 125 CDCWCKPGLIRDSIAHKC---VKECPKYDEILD 214 C C+PG+I+ C +C +Y+ + D Sbjct: 539 CSLPCEPGMIKKQQGDTCCWVCDQCEEYEYVYD 571 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 1.5 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +2 Query: 125 CDCWCKPGLIRDSIAHKCVKECPKYDE 205 C C+PG+I+ C C + +E Sbjct: 449 CSLPCEPGMIKKQQGDTCCWVCDQCEE 475 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.0 bits (42), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 74 RRNLDPDRIGPVDIPQS 24 RRN P GP D P+S Sbjct: 55 RRNPGPGSKGPRDFPRS 71 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.2 bits (40), Expect = 8.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 Query: 133 LVQAWPHKGLYRSQMCER 186 +V+ H GLY Q C R Sbjct: 6 VVRGIEHGGLYYHQRCSR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,400 Number of Sequences: 438 Number of extensions: 2290 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8804355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -