BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30198 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 26 0.87 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 26 0.87 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 26 0.87 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 26 0.87 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 2.0 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 2.0 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 4.6 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 25.8 bits (54), Expect = 0.87 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 365 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 493 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 334 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 377 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.8 bits (54), Expect = 0.87 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 365 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 493 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 104 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 147 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 25.8 bits (54), Expect = 0.87 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 365 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 493 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 110 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 153 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.8 bits (54), Expect = 0.87 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 365 FDDAIAE-LDTLNEDSYKDSTLIMQLLRD-NLTLWTSDTQGDGDE 493 FDD + + L++ EDS D TLI + L D + ++ S + DGD+ Sbjct: 104 FDDDVGDRLESEEEDS-TDETLIEEELTDTDSSMCDSTNEDDGDD 147 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 210 IHRKHTKMLLKSARRK-CSPH 269 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 210 IHRKHTKMLLKSARRK-CSPH 269 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 4.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 335 LANLISHNKRLRNLTPDPALWGVWA 261 LAN + N+ R T + ++GVWA Sbjct: 16 LANEFNPNRGRRRPTKNQQIYGVWA 40 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,325 Number of Sequences: 2352 Number of extensions: 10540 Number of successful extensions: 72 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -