BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30198 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 26 0.26 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 26 0.26 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 7.5 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 7.5 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 10.0 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 25.8 bits (54), Expect = 0.26 Identities = 9/37 (24%), Positives = 16/37 (43%) Frame = -1 Query: 270 CVGCIFALLISKASWYAFCESSTTECLVSPVATSARY 160 C CI + S W +C S+ C+ + + R+ Sbjct: 35 CRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRF 71 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 25.8 bits (54), Expect = 0.26 Identities = 9/37 (24%), Positives = 16/37 (43%) Frame = -1 Query: 270 CVGCIFALLISKASWYAFCESSTTECLVSPVATSARY 160 C CI + S W +C S+ C+ + + R+ Sbjct: 483 CRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRF 519 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 17 KEYRVKVEKELREICYDV 70 K+YRVK E+E +++ +V Sbjct: 113 KKYRVKFEEEAKKLGINV 130 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +2 Query: 17 KEYRVKVEKELREICYDV 70 K+YRVK E+E +++ +V Sbjct: 113 KKYRVKFEEEAKKLGINV 130 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 20.6 bits (41), Expect = 10.0 Identities = 5/8 (62%), Positives = 8/8 (100%) Frame = +1 Query: 190 QTFCCRGF 213 +TFCC+G+ Sbjct: 455 KTFCCKGY 462 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,808 Number of Sequences: 438 Number of extensions: 2499 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -