BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30197 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02360.1 68414.m00182 chitinase, putative similar to chitinas... 30 0.80 At3g54420.1 68416.m06019 class IV chitinase (CHIV) almost identi... 29 1.4 At4g14350.2 68417.m02211 protein kinase family protein contains ... 29 2.5 At4g14350.1 68417.m02210 protein kinase family protein contains ... 29 2.5 At3g23310.1 68416.m02940 protein kinase, putative contains prote... 29 2.5 At4g32820.1 68417.m04668 expressed protein ; expression supporte... 27 5.7 At4g15180.1 68417.m02328 SET domain-containing protein contains ... 27 5.7 At1g77410.1 68414.m09015 beta-galactosidase, putative / lactase,... 27 5.7 At1g70680.1 68414.m08148 caleosin-related family protein similar... 27 7.5 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 27 9.9 >At1g02360.1 68414.m00182 chitinase, putative similar to chitinase precursor GI:5880845 from [Petroselinum crispum] Length = 272 Score = 30.3 bits (65), Expect = 0.80 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +2 Query: 140 HKYGPSGTVQKFDGLCVLPLNIVNEKIYVF---LWFW 241 + YGP+G FDGL P + N + F LWFW Sbjct: 152 YNYGPAGRALGFDGL-RNPETVSNNSVIAFQTALWFW 187 >At3g54420.1 68416.m06019 class IV chitinase (CHIV) almost identical to class IV chitinase from GI:2597826 [Arabidopsis thaliana] Length = 273 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +2 Query: 146 YGPSGTVQKFDGLCVLPLNIVNEKIYVF---LWFW 241 YGP+GT FDGL P + + + F LW+W Sbjct: 183 YGPAGTAIGFDGLNA-PETVATDPVISFKTALWYW 216 >At4g14350.2 68417.m02211 protein kinase family protein contains similarity to Swiss-Prot:O13310 serine/threonine-protein kinase orb6 [Schizosaccharomyces pombe] Length = 551 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 395 DWFVLYQLGKNIDPLIYKELMTELAEKFEGNDK 493 +W LYQ+ P + EL T+ EKFE DK Sbjct: 422 EWGKLYQMKAAFIPQVNDELDTQNFEKFEETDK 454 >At4g14350.1 68417.m02210 protein kinase family protein contains similarity to Swiss-Prot:O13310 serine/threonine-protein kinase orb6 [Schizosaccharomyces pombe] Length = 551 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 395 DWFVLYQLGKNIDPLIYKELMTELAEKFEGNDK 493 +W LYQ+ P + EL T+ EKFE DK Sbjct: 422 EWGKLYQMKAAFIPQVNDELDTQNFEKFEETDK 454 >At3g23310.1 68416.m02940 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 568 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 395 DWFVLYQLGKNIDPLIYKELMTELAEKFEGNDK 493 +W LYQ+ P + EL T+ EKFE DK Sbjct: 425 EWEKLYQMKAAFIPQVNDELDTQNFEKFEETDK 457 >At4g32820.1 68417.m04668 expressed protein ; expression supported by MPSS Length = 1817 Score = 27.5 bits (58), Expect = 5.7 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 6/95 (6%) Frame = -3 Query: 352 WRKATACAQQVETDAGSSDNG--HAV*QRNST-QDR*YHKPKPEEHVDLLVDDIQWQNTQ 182 WRK +A +Q+VET S ++ NS Q H+ + D L + + + + Sbjct: 1121 WRKNSALSQRVETSRRRSRRCLLMSLALANSPDQQSEIHELLALVYYDSLQSVVPFYDQR 1180 Query: 181 AIEFLHRTGWTVFMEGAFSYFRKHSGHR---VHAF 86 ++ WT F E + +F K HR HAF Sbjct: 1181 SVLPSKDATWTRFCENSMKHFNKAFSHRQDWSHAF 1215 >At4g15180.1 68417.m02328 SET domain-containing protein contains Pfam profile PF00856: SET domain Length = 2326 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 380 KLQIGDWFVLYQLGKNIDPLIYKELMTELAEK 475 +L IGDWF G+ PL + EL +L EK Sbjct: 977 QLHIGDWFYTDGAGQEQGPLSFSELQ-KLVEK 1007 >At1g77410.1 68414.m09015 beta-galactosidase, putative / lactase, putative similar to beta-galactosidase SP:P45582 from [Asparagus officinalis] Length = 815 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 139 EGAFSYFR-KHSGHRVHAFLGLHFCEADHVTAIS*KFSVQKEV 14 EGA S + H GH +HAF+ F + H T + +F ++K + Sbjct: 480 EGAPSVLKVNHLGHALHAFVNGRFIGSMHGTFKAHRFLLEKNM 522 >At1g70680.1 68414.m08148 caleosin-related family protein similar to Ca+2-binding EF hand protein GB:AAB71227 [Glycine max]; contains Pfam profilePF05042: Caleosin related protein Length = 192 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 383 LQIGDWFVLYQLGKNIDPLIYKELM 457 L G+W VLY L K+ L++KE++ Sbjct: 147 LAFGEWKVLYNLCKDKSGLLHKEIV 171 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 274 FVIPHGRCR--WTPRPSLLAARTQSPC 348 F + H R WTPRP + + SPC Sbjct: 12 FQVTHFRSTKPWTPRPEIYPFKVNSPC 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,618,232 Number of Sequences: 28952 Number of extensions: 238664 Number of successful extensions: 666 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 665 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -