BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30194 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2... 27 2.2 SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|... 25 6.7 SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces po... 25 6.7 >SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 825 Score = 26.6 bits (56), Expect = 2.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -3 Query: 448 PPLEKVWQERAEQFGGRQKARLPKWFGERPGKKKGELES 332 PP EK +R E + ++P W ++ G KKGE S Sbjct: 394 PPREKRMGQRHETYNSYLPLKVPDW--KKYGVKKGETTS 430 >SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|Schizosaccharomyces pombe|chr 2|||Manual Length = 287 Score = 25.0 bits (52), Expect = 6.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 397 QKARLPKWFGERP 359 QK RLP+W G+ P Sbjct: 84 QKDRLPRWIGDNP 96 >SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 472 Score = 25.0 bits (52), Expect = 6.7 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 117 SYSFVTNPLTYCYYNMNKI 61 SY+ V +YCY+++NK+ Sbjct: 183 SYNVVNGWYSYCYHSLNKL 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,299,064 Number of Sequences: 5004 Number of extensions: 17922 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -