BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30194 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 52 2e-07 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 2e-07 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 52 2e-07 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 52 2e-07 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 52 2e-07 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 52 2e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 47 1e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 46 2e-05 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 43 2e-04 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 36 0.020 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 30 1.3 SB_50447| Best HMM Match : ProQ (HMM E-Value=0.44) 29 2.3 SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 27 6.9 SB_18320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 5 HDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 61 HDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 629 HDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 40 HDVVKRRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 42 HDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 1880 HDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 40 HDVVKRRPVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 34 HDVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 83 HDVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 61 HDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 72 HDVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 48 HDVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRANW 457 HDVVKRRPVNCNTTHYRANW Sbjct: 72 HDVVKRRPVNCNTTHYRANW 91 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 48.0 bits (109), Expect = 5e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRAN 460 HDVVKRRPVNCNTTHYRAN Sbjct: 22 HDVVKRRPVNCNTTHYRAN 40 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +1 Query: 421 SLATPSRGGARYPIRPIVSRITIHWPSFYN 510 S A + GGA PIRPIVSRITIHWP+FYN Sbjct: 29 SRAAATDGGA--PIRPIVSRITIHWPAFYN 56 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +1 Query: 421 SLATPSRGGARYPIRPIVSRITIHWPSFYNVV 516 S A + GGA PIRPIVS ITIHWPSFYN V Sbjct: 31 SRAAATVGGA--PIRPIVSHITIHWPSFYNGV 60 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -1 Query: 516 HDVVKRRPVNCNTTHYRAN 460 HD KRRPVNCNTTHYRAN Sbjct: 79 HDGEKRRPVNCNTTHYRAN 97 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 5e-04 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +1 Query: 460 IRPIVSRITIHWPSFYNVV 516 +RP+VSRITIHW SFYNVV Sbjct: 33 LRPVVSRITIHWTSFYNVV 51 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 460 IRPIVSRITIHWPSFY 507 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 466 PIVSRITIHWPSFYNVV 516 P +SRITIHWPSFYNVV Sbjct: 77 PYMSRITIHWPSFYNVV 93 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.7 bits (76), Expect = 0.046 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 475 SRITIHWPSFYNVV 516 SRITIHWPSFYNV+ Sbjct: 2 SRITIHWPSFYNVM 15 >SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) Length = 634 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = -1 Query: 480 TTHYRANWVPG---PPSRRCGKRGPNSSAAGKRR 388 T H + +W PG PP CG+ P+++++G R Sbjct: 330 TAHAQKSWTPGCCFPPRLGCGRSYPDTNSSGTSR 363 >SB_50447| Best HMM Match : ProQ (HMM E-Value=0.44) Length = 295 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -1 Query: 513 DVVKRRPVNCNTTHYRANWVPGPPSRRCGKRGPNSSAAGKRR 388 D ++ P T H A+ P P R K P A GK+R Sbjct: 243 DEIEEEPPAKRTRHSAASTTPSPRKGRQKKSSPTKQAMGKKR 284 >SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 5.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 468 RANWVPGPPSRRCGK 424 R++W P PPS+ CG+ Sbjct: 139 RSDWTPAPPSKICGR 153 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 459 WVPGPPSRRCGKRGP 415 WVPGP RR RGP Sbjct: 264 WVPGPEQRRDNMRGP 278 >SB_18320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 406 RTVRPSLATPSRGGARYPIRPIVSR 480 +T PSL TP+ G YPI+ + S+ Sbjct: 1 KTAFPSLTTPATKGTGYPIKTVQSQ 25 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 490 HWPSFYNVV 516 HWPSFYNVV Sbjct: 5 HWPSFYNVV 13 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 490 HWPSFYNVV 516 HWPSFYNVV Sbjct: 62 HWPSFYNVV 70 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 490 HWPSFYNVV 516 HWPSFYNVV Sbjct: 5 HWPSFYNVV 13 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 490 HWPSFYNVV 516 HWPSFYNVV Sbjct: 57 HWPSFYNVV 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,366,339 Number of Sequences: 59808 Number of extensions: 157250 Number of successful extensions: 911 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -